DY258624

Overview
NameDY258624
Unique NameDY258624
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1280
Libraries
Library NameType
AbsDev1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DY258624_ssr132 microsatellite DY258624_ssr132:132..143. BLAST: Citrus ESTs to Prunus persica proteins V1
DY258624_ssr39 microsatellite DY258624_ssr39:39..50. BLAST: Citrus ESTs to Prunus persica proteins V1
DY258624_ssr781 microsatellite DY258624_ssr781:781..792. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11B_TOBAC (Ras-related protein Rab11B OS=Nicotiana tabacum GN=RAB11B PE=2 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 9.467e-96
Identity = 174/197 (88.32%), Postives = 188/197 (95.43%), Query Frame = 3
Query:  222 GAYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLPKGQII 812
            G YRA+DDYDYLFK+VLIGDSGVGKSNLLSRF++NEF+LESKSTIGVEFATRSIRVDDK+VKAQIWDTAGQERYRAITSAYYRGAVGAL+VYD+TRHVTFENVERWLKELRDHTD NIVIMLVGNKADLRHLRAVSTEDA++FAE+ENTFFMETSALESLNVENA  EVLT+IY+VV R+ALEV DDP  LPKGQ I
Sbjct:    3 GGYRAEDDYDYLFKLVLIGDSGVGKSNLLSRFSRNEFNLESKSTIGVEFATRSIRVDDKIVKAQIWDTAGQERYRAITSAYYRGAVGALVVYDITRHVTFENVERWLKELRDHTDQNIVIMLVGNKADLRHLRAVSTEDAKAFAERENTFFMETSALESLNVENAFTEVLTEIYKVVCRKALEVGDDPAALPKGQTI 199          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RIC2_ORYSJ (Ras-related protein RIC2 OS=Oryza sativa subsp. japonica GN=RIC2 PE=2 SV=2)

HSP 1 Score: 314.309 bits (804), Expect = 2.778e-88
Identity = 158/196 (80.61%), Postives = 178/196 (90.82%), Query Frame = 3
Query:  228 YRADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLP-KGQII 812
            YRA+DDYDYLFKVVLIGDSGVGKSNLLSRFT+NEFSLESKSTIGVEFATRS++VD KVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRH TFENVERWLKELRDHTD NIV+MLVGNK+DLRHL AV T++ ++FAE+E+ +FMETSALES NVENA  EVLTQIYR+V++ ++E  DD  + P KG+ I
Sbjct:    5 YRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLQVDGKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLKELRDHTDPNIVVMLVGNKSDLRHLVAVQTDEGKAFAERESLYFMETSALESTNVENAFAEVLTQIYRIVSKRSVEAGDDAGSGPGKGEKI 200          

HSP 2 Score: 31.187 bits (69), Expect = 2.778e-88
Identity = 14/22 (63.64%), Postives = 15/22 (68.18%), Query Frame = 2
Query:  800 GSNYYIGTKDNVSAVKKTGCCS 865
            G    I  KD+VSAVKK GCCS
Sbjct:  195 GKGEKINIKDDVSAVKKGGCCS 216          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RAA1C_ARATH (Ras-related protein RABA1c OS=Arabidopsis thaliana GN=RABA1C PE=1 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 8.043e-88
Identity = 156/193 (80.83%), Postives = 174/193 (90.16%), Query Frame = 3
Query:  219 MGAYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLP 797
            M  YRADD+YDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRS+ VDDKV+KAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRH TFENVE WLKELR+HTD NIV+MLVGNK+DLRHL AV TEDA+SFAEKE+ +FMETSALE+ NVENA  EVLTQI+ +V+++A+E   +   +P
Sbjct:    1 MAGYRADDEYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSLNVDDKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVETWLKELRNHTDPNIVVMLVGNKSDLRHLVAVQTEDAKSFAEKESLYFMETSALEATNVENAFAEVLTQIHHIVSKKAMEAASESANVP 193          

HSP 2 Score: 27.7202 bits (60), Expect = 8.043e-88
Identity = 14/25 (56.00%), Postives = 17/25 (68.00%), Query Frame = 2
Query:  791 PAQGSNYYIGTKDNVSAVKKTGCCS 865
            P++G    IG   +VSAVKK GCCS
Sbjct:  193 PSKGDKIDIGK--DVSAVKKGGCCS 215          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: YPT3_NICPL (Ras-related protein YPT3 OS=Nicotiana plumbaginifolia GN=YPT3 PE=2 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 3.633e-85
Identity = 153/201 (76.12%), Postives = 178/201 (88.56%), Query Frame = 3
Query:  219 MGAYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTL---PKGQII 812
            M  YRADD+YDYLFK+VLIGDSGVGKSNLLSRFTKNEF+LESKSTIGVEFAT+S+ +D+KV+KAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVT+ENV RWLKELRDHTD NIV+ML+GNK+DLRHL AVST++A+  AE+E  +FMETSALE+ NVENA  E LTQIYR+V+++A+E  D+  T    PKG+ I
Sbjct:    1 MAGYRADDEYDYLFKLVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATKSLNIDNKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTYENVTRWLKELRDHTDPNIVVMLIGNKSDLRHLVAVSTDEAKGLAEREGLYFMETSALEATNVENAFTEALTQIYRIVSKKAVEAGDEGATSSAPPKGETI 201          

HSP 2 Score: 23.483 bits (49), Expect = 3.633e-85
Identity = 10/17 (58.82%), Postives = 11/17 (64.71%), Query Frame = 2
Query:  815 IGTKDNVSAVKKTGCCS 865
            I  KD  S+ KK GCCS
Sbjct:  201 INIKDEGSSWKKFGCCS 217          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11D_LOTJA (Ras-related protein Rab11D OS=Lotus japonicus GN=RAB11D PE=2 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 5.181e-84
Identity = 156/201 (77.61%), Postives = 175/201 (87.06%), Query Frame = 3
Query:  219 MGAYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPT--LP-KGQII 812
            MG YR DD+YDYLFK+VLIGDSGVGKSNLLSRFTKNEF+LESKSTIGVEFAT+++ VD KVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTR  TFEN  RWLKELRDHTD NIV+ML+GNK+DLRHL AV TED +SFAE+E+ +FMETSALE+ NVENA  EVLTQIYR+V++ A+E  D   +  LP KGQ I
Sbjct:    1 MGGYRTDDEYDYLFKLVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATKTLNVDAKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRRATFENAARWLKELRDHTDPNIVVMLIGNKSDLRHLVAVPTEDGKSFAERESLYFMETSALEATNVENAFTEVLTQIYRIVSKRAVEAGDSGSSSGLPSKGQTI 201          

HSP 2 Score: 23.8682 bits (50), Expect = 5.181e-84
Identity = 10/25 (40.00%), Postives = 16/25 (64.00%), Query Frame = 2
Query:  791 PAQGSNYYIGTKDNVSAVKKTGCCS 865
            P++G    I  K++ S +K+ GCCS
Sbjct:  195 PSKGQT--INVKEDSSVLKRFGCCS 217          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RAA1B_ARATH (Ras-related protein RABA1b OS=Arabidopsis thaliana GN=RABA1B PE=2 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 8.817e-84
Identity = 151/199 (75.88%), Postives = 176/199 (88.44%), Query Frame = 3
Query:  219 MGAYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDD-PPTLPKGQII 812
            M  YR +DDYDYLFKVVLIGDSGVGKSNLLSRFTKNEF+LESKSTIGVEFATR+++VD KVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTR  TFENV+RWLKEL++HTD NIV+MLVGNK+DLRHL AV TED +S+AE+E+  FMETSALE+ NVE+A  EVLTQIYR+ +++ +E  +D   ++PKG+ I
Sbjct:    1 MAGYRVEDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATRTLKVDGKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRRATFENVDRWLKELKNHTDPNIVVMLVGNKSDLRHLLAVPTEDGKSYAEQESLCFMETSALEATNVEDAFAEVLTQIYRITSKKQVEAGEDGNASVPKGEKI 199          

HSP 2 Score: 27.335 bits (59), Expect = 8.817e-84
Identity = 11/17 (64.71%), Postives = 14/17 (82.35%), Query Frame = 2
Query:  815 IGTKDNVSAVKKTGCCS 865
            I  K++VSA+KK GCCS
Sbjct:  199 IEVKNDVSALKKLGCCS 215          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11E_LOTJA (Ras-related protein Rab11E OS=Lotus japonicus GN=RAB11E PE=2 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 7.781e-82
Identity = 148/191 (77.49%), Postives = 169/191 (88.48%), Query Frame = 3
Query:  219 MGAYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPT 791
            M  Y+ADD+YDYLFK+VLIGDSGVGKSNLLSRFT+NEF+LESKSTIGVEFAT+S+ +D KV+KAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTR  TFE   RWLKELRDHTD NIV+ML+GNK+DLRHL  VSTED ++FAEKE+ +FMETSALE+ NVENA  EVLTQIYR+V++ A+E  D P T
Sbjct:    1 MAGYKADDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATKSLNIDGKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRSTTFETAGRWLKELRDHTDPNIVVMLIGNKSDLRHLVTVSTEDGKAFAEKESLYFMETSALEATNVENAFSEVLTQIYRIVSKRAVEAGDRPST 191          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: YPTC6_CHLRE (Ras-related protein YPTC6 OS=Chlamydomonas reinhardtii GN=YPTC6 PE=3 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 5.043e-81
Identity = 147/199 (73.87%), Postives = 175/199 (87.94%), Query Frame = 3
Query:  225 AYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLPKGQIIILV 821
            +++ DDDYDYLFKVVLIGDSGVGKSNLLSRFT+NEFSLESKSTIGVEFATRSI+VD K +KAQIWDTAGQERYRAITSAYYRGAVGALLVYD+T+ VTFENVERWLKELRDH DSNIVIMLVGNK+DL+HLR V TE AQ+F E+E   F+ETSALES NVE A  ++LT+IY +V+++ L+  D+ P + +G+ +I++
Sbjct:    2 SHKPDDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKSVTFENVERWLKELRDHADSNIVIMLVGNKSDLKHLRDVQTEVAQAFCEREGLSFIETSALESTNVEKAFQQILTEIYHIVSKKVLDSEDNRPKIGEGRDVIVI 200          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RAA1A_ARATH (Ras-related protein RABA1a OS=Arabidopsis thaliana GN=RABA1A PE=2 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 6.165e-79
Identity = 144/199 (72.36%), Postives = 174/199 (87.44%), Query Frame = 3
Query:  219 MGAYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLP-KGQII 812
            M  YRAD++YDYLFK+VLIGDSGVGKSNLLSRFTKNEF+LESKSTIGVEFAT++ +V+ KVVKAQIWDTAGQERYRAITSAYYRGAVGALL+YDVTRH TFEN  RWL+ELR HTD NIV+ML+GNK DLRHL AV TE+A++FAE+E+ +FMETSAL++ NVENA  EVLTQI+++V++ +++   +   LP KG+ I
Sbjct:    1 MAGYRADEEYDYLFKLVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATKTTKVEGKVVKAQIWDTAGQERYRAITSAYYRGAVGALLIYDVTRHATFENAARWLRELRGHTDPNIVVMLIGNKCDLRHLVAVKTEEAKAFAERESLYFMETSALDATNVENAFTEVLTQIHKIVSKRSVDGGGESADLPGKGETI 199          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11B_RAT (Ras-related protein Rab-11B OS=Rattus norvegicus GN=Rab11b PE=2 SV=4)

HSP 1 Score: 291.197 bits (744), Expect = 8.902e-78
Identity = 142/192 (73.96%), Postives = 167/192 (86.98%), Query Frame = 3
Query:  237 DDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLPKGQII 812
            DD+YDYLFKVVLIGDSGVGKSNLLSRFT+NEF+LESKSTIGVEFATRSI+VD K +KAQIWDTAGQERYRAITSAYYRGAVGALLVYD+ +H+T+ENVERWLKELRDH DSNIVIMLVGNK+DLRHLRAV T++A++FAEK N  F+ETSAL+S NVE A   +LT+IYR+V+++ +  R      P   ++
Sbjct:    5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVV 196          
The following BLAST results are available for this feature:
BLAST of DY258624 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RB11B_TOBAC9.467e-9688.32Ras-related protein Rab11B OS=Nicotiana tabacum GN... [more]
RIC2_ORYSJ2.778e-8880.61Ras-related protein RIC2 OS=Oryza sativa subsp. ja... [more]
RAA1C_ARATH8.043e-8880.83Ras-related protein RABA1c OS=Arabidopsis thaliana... [more]
YPT3_NICPL3.633e-8576.12Ras-related protein YPT3 OS=Nicotiana plumbaginifo... [more]
RB11D_LOTJA5.181e-8477.61Ras-related protein Rab11D OS=Lotus japonicus GN=R... [more]
RAA1B_ARATH8.817e-8475.88Ras-related protein RABA1b OS=Arabidopsis thaliana... [more]
RB11E_LOTJA7.781e-8277.49Ras-related protein Rab11E OS=Lotus japonicus GN=R... [more]
YPTC6_CHLRE5.043e-8173.87Ras-related protein YPTC6 OS=Chlamydomonas reinhar... [more]
RAA1A_ARATH6.165e-7972.36Ras-related protein RABA1a OS=Arabidopsis thaliana... [more]
RB11B_RAT8.902e-7873.96Ras-related protein Rab-11B OS=Rattus norvegicus G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAI2CG06FM1 AbsDev1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY258624 ID=DY258624; Name=DY258624; organism=Citrus clementina; type=EST; length=1280bp
CCCTTCTTAATTTGCAATGTTAATAACATTACTCAAACAAGAAGAAGAAG
AATAGCGAAAGCCTTAGATTTTCTTCATCTGTTCCCATCATCAACTTCAC
CTCACCTGTCTTGCACACACACTCACACTTATCTCTCTCTCTCTATTGCG
TTAATTGCATAATACACAATTCAATAAGAGAGGAGGGGAAAAAAAAAAGA
AGAAAGAAATTGAAAAAAATGGGAGCATACAGAGCTGACGACGACTACGA
TTACTTGTTCAAGGTGGTGTTAATTGGAGATTCAGGAGTTGGGAAATCAA
ATCTGTTATCTCGATTCACCAAGAACGAATTCAGCCTCGAATCGAAATCC
ACCATCGGCGTCGAATTCGCCACTCGCAGCATTCGCGTCGACGACAAGGT
CGTCAAGGCTCAGATTTGGGACACCGCCGGCCAAGAACGATATCGTGCTA
TCACAAGTGCGTACTACCGGGGAGCTGTTGGTGCCTTGCTTGTCTATGAT
GTCACCCGACATGTTACTTTTGAGAATGTTGAGAGATGGTTGAAAGAGCT
TCGGGATCACACAGACTCAAACATTGTGATAATGCTTGTGGGTAACAAGG
CTGATTTGCGTCACTTGCGTGCTGTTTCAACTGAGGATGCTCAGTCGTTC
GCTGAGAAAGAGAACACTTTCTTCATGGAAACCTCTGCCCTAGAGTCGTT
GAATGTTGAAAATGCCCTCCCCGAAGTGCTCACTCAGATATATCGAGTTG
TTAACAGGGAGGCTCTTGAGGTAAGGGATGACCCACCCACCCTGCCCAAG
GGTCAAATTATTATATTGGTACAAAAGATAATGTATCGGCTGTGAAAAAA
ACTGGGTGCTGCTCCTGCATATCCTGCCACCTTCCAAGGAAAATCCCGGG
GGCTAAAAAAAAGTTTCCCCTCTTTTTAAAAATTTAACTTTCCCTTGGTT
TGGAAAAACTCTTGGGTTTTAACTTGGCTGCCCGGAAAAAAAAAAACATG
GGAGGTGCAGGAAAAAAATTTAAGTTTTTACATTTTTCACTCGGGACCCG
GGAAATCTCCCAAATCCTGGGTTGGAAATATAGGGTAAAAAGCCAAAAAT
CTTTTTGGGAATTGGAAAACCCTCCGGGTTTGGTGGGAAGAACCCCACAC
GGTTTTTTTTTTCTTTTTTTGGTGTATTGTCCCTCTTTTGTTTTGTCCCC
CCCCAAAAAAAAAAAATTGGTGAAAAAAAAGTTGTTTTACCCACCCCCCC
CCCCAAAAAACACCCTCCCCAAAAAGAGAA
back to top