DY258625

Overview
NameDY258625
Unique NameDY258625
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1249
Libraries
Library NameType
AbsDev1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY258625 vs. ExPASy Swiss-Prot
Match: ERLN2_RAT (Erlin-2 OS=Rattus norvegicus GN=Erlin2 PE=1 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 1.204e-71
Identity = 131/218 (60.09%), Postives = 170/218 (77.98%), Query Frame = 2
Query:  209 HQIPEGHVGVYWRGGALLETITHPGFHLKLPLITHYEPVQVTLQTDQVTDIPCGTKGGVMINFEKIEVVNRLRKEYVYETLRDYGVQYDKTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDEKMKDALQVDCTRYAPGIEIISVRVTKPTIPDRIRRNFEQMEEERTRVLIAIEKQKVAEKEAETSKKMAISEAEKNANVSKILMEQKLMGKDSARK 862
            H+I EGH+GVY+RGGALL + + PGFHL LP IT Y+ VQ TLQTD+V ++PCGT GGVMI F++IEVVN L    VY+ +++Y   YDK  I++KIHHE+NQFCS H+LQ+VYI++FDQIDE +K ALQ D T  APG+ I +VRVTKP IP+ IRRN+E ME E+T++LIA +KQKV EKEAET +K A+ EAEK A V++I   QK+M K++ +K
Sbjct:   24 HKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIRRNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKK 241          
BLAST of DY258625 vs. ExPASy Swiss-Prot
Match: ERLN2_PONAB (Erlin-2 OS=Pongo abelii GN=ERLIN2 PE=2 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 1.204e-71
Identity = 131/218 (60.09%), Postives = 170/218 (77.98%), Query Frame = 2
Query:  209 HQIPEGHVGVYWRGGALLETITHPGFHLKLPLITHYEPVQVTLQTDQVTDIPCGTKGGVMINFEKIEVVNRLRKEYVYETLRDYGVQYDKTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDEKMKDALQVDCTRYAPGIEIISVRVTKPTIPDRIRRNFEQMEEERTRVLIAIEKQKVAEKEAETSKKMAISEAEKNANVSKILMEQKLMGKDSARK 862
            H+I EGH+GVY+RGGALL + + PGFHL LP IT Y+ VQ TLQTD+V ++PCGT GGVMI F++IEVVN L    VY+ +++Y   YDK  I++KIHHE+NQFCS H+LQ+VYI++FDQIDE +K ALQ D T  APG+ I +VRVTKP IP+ IRRN+E ME E+T++LIA +KQKV EKEAET +K A+ EAEK A V++I   QK+M K++ +K
Sbjct:   24 HKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIRRNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKK 241          
BLAST of DY258625 vs. ExPASy Swiss-Prot
Match: ERLN2_MOUSE (Erlin-2 OS=Mus musculus GN=Erlin2 PE=1 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 1.204e-71
Identity = 131/218 (60.09%), Postives = 170/218 (77.98%), Query Frame = 2
Query:  209 HQIPEGHVGVYWRGGALLETITHPGFHLKLPLITHYEPVQVTLQTDQVTDIPCGTKGGVMINFEKIEVVNRLRKEYVYETLRDYGVQYDKTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDEKMKDALQVDCTRYAPGIEIISVRVTKPTIPDRIRRNFEQMEEERTRVLIAIEKQKVAEKEAETSKKMAISEAEKNANVSKILMEQKLMGKDSARK 862
            H+I EGH+GVY+RGGALL + + PGFHL LP IT Y+ VQ TLQTD+V ++PCGT GGVMI F++IEVVN L    VY+ +++Y   YDK  I++KIHHE+NQFCS H+LQ+VYI++FDQIDE +K ALQ D T  APG+ I +VRVTKP IP+ IRRN+E ME E+T++LIA +KQKV EKEAET +K A+ EAEK A V++I   QK+M K++ +K
Sbjct:   24 HKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIRRNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKK 241          
BLAST of DY258625 vs. ExPASy Swiss-Prot
Match: ERLN2_HUMAN (Erlin-2 OS=Homo sapiens GN=ERLIN2 PE=1 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 1.204e-71
Identity = 131/218 (60.09%), Postives = 170/218 (77.98%), Query Frame = 2
Query:  209 HQIPEGHVGVYWRGGALLETITHPGFHLKLPLITHYEPVQVTLQTDQVTDIPCGTKGGVMINFEKIEVVNRLRKEYVYETLRDYGVQYDKTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDEKMKDALQVDCTRYAPGIEIISVRVTKPTIPDRIRRNFEQMEEERTRVLIAIEKQKVAEKEAETSKKMAISEAEKNANVSKILMEQKLMGKDSARK 862
            H+I EGH+GVY+RGGALL + + PGFHL LP IT Y+ VQ TLQTD+V ++PCGT GGVMI F++IEVVN L    VY+ +++Y   YDK  I++KIHHE+NQFCS H+LQ+VYI++FDQIDE +K ALQ D T  APG+ I +VRVTKP IP+ IRRN+E ME E+T++LIA +KQKV EKEAET +K A+ EAEK A V++I   QK+M K++ +K
Sbjct:   24 HKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIRRNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKK 241          
BLAST of DY258625 vs. ExPASy Swiss-Prot
Match: ERLN2_BOVIN (Erlin-2 OS=Bos taurus GN=ERLIN2 PE=2 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 2.054e-71
Identity = 130/218 (59.63%), Postives = 170/218 (77.98%), Query Frame = 2
Query:  209 HQIPEGHVGVYWRGGALLETITHPGFHLKLPLITHYEPVQVTLQTDQVTDIPCGTKGGVMINFEKIEVVNRLRKEYVYETLRDYGVQYDKTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDEKMKDALQVDCTRYAPGIEIISVRVTKPTIPDRIRRNFEQMEEERTRVLIAIEKQKVAEKEAETSKKMAISEAEKNANVSKILMEQKLMGKDSARK 862
            H+I EGH+GVY+RGGALL + + PGFHL LP IT Y+ VQ TLQTD+V ++PCGT GGVMI F++IEVVN L    VY+ +++Y   YDK  I++KIHHE+NQFCS H+LQ+VYI++FDQIDE +K ALQ D T  APG+ I +VRVTKP IP+ IRRN+E ME E+T++LIA +KQKV EKEAET +K A+ EAEK A V++I   QK+M K++ ++
Sbjct:   24 HKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIRRNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITFGQKVMEKETEKR 241          
BLAST of DY258625 vs. ExPASy Swiss-Prot
Match: ERL2B_XENLA (Erlin-2-B OS=Xenopus laevis GN=erlin2-B PE=2 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 3.504e-71
Identity = 133/218 (61.01%), Postives = 169/218 (77.52%), Query Frame = 2
Query:  209 HQIPEGHVGVYWRGGALLETITHPGFHLKLPLITHYEPVQVTLQTDQVTDIPCGTKGGVMINFEKIEVVNRLRKEYVYETLRDYGVQYDKTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDEKMKDALQVDCTRYAPGIEIISVRVTKPTIPDRIRRNFEQMEEERTRVLIAIEKQKVAEKEAETSKKMAISEAEKNANVSKILMEQKLMGKDSARK 862
            H+I EGHVGVY+RGGALL T + PGFHL LP IT ++ VQ TLQTD+V ++PCGT GGVMI F++IEVVN L    VY+ +++Y   YDK  I++KIHHE+NQFCS H+LQ+VYI++FDQIDE +K ALQ D    APGI I +VRVTKP IP+ IRRN+E ME E+T++LIA +KQKV EKEAET +K AI EAEK A V++I   QK+M K++ +K
Sbjct:   24 HKIEEGHVGVYYRGGALLTTTSGPGFHLMLPFITSFKSVQSTLQTDEVKNVPCGTSGGVMIYFDRIEVVNYLISSAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHNLQEVYIELFDQIDEDLKLALQKDLNLMAPGIIIQAVRVTKPNIPEAIRRNYELMESEKTKLLIAAQKQKVVEKEAETERKKAIIEAEKVAQVAQIKYGQKVMEKETEKK 241          
BLAST of DY258625 vs. ExPASy Swiss-Prot
Match: ERLN2_XENTR (Erlin-2 OS=Xenopus tropicalis GN=erlin2 PE=2 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 4.577e-71
Identity = 131/218 (60.09%), Postives = 170/218 (77.98%), Query Frame = 2
Query:  209 HQIPEGHVGVYWRGGALLETITHPGFHLKLPLITHYEPVQVTLQTDQVTDIPCGTKGGVMINFEKIEVVNRLRKEYVYETLRDYGVQYDKTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDEKMKDALQVDCTRYAPGIEIISVRVTKPTIPDRIRRNFEQMEEERTRVLIAIEKQKVAEKEAETSKKMAISEAEKNANVSKILMEQKLMGKDSARK 862
            H+I EGHVGVY+RGGALL + + PGFHL LP IT ++ VQ T+QTD+V ++PCGT GGVMI F++IEVVN L    VY+ +++Y   YDKT I++KIHHE+NQFCS H+LQ+VYI++FDQIDE +K ALQ D    APG+ I +VRVTKP IP+ IRRN+E ME E+T++LIA +KQKV EKEAET +K AI EAEK A V++I   QK+M K++ +K
Sbjct:   24 HKIEEGHVGVYYRGGALLTSTSGPGFHLMLPFITSFKSVQSTMQTDEVKNVPCGTSGGVMIYFDRIEVVNYLIPSAVYDIVKNYTADYDKTLIFNKIHHELNQFCSVHNLQEVYIELFDQIDENLKLALQKDLNSMAPGLVIQAVRVTKPNIPEAIRRNYELMESEKTKLLIAAQKQKVVEKEAETERKKAIIEAEKVAQVAEIKYGQKVMEKETEKK 241          
BLAST of DY258625 vs. ExPASy Swiss-Prot
Match: ERLN1_MOUSE (Erlin-1 OS=Mus musculus GN=Erlin1 PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 2.271e-70
Identity = 127/218 (58.26%), Postives = 169/218 (77.52%), Query Frame = 2
Query:  209 HQIPEGHVGVYWRGGALLETITHPGFHLKLPLITHYEPVQVTLQTDQVTDIPCGTKGGVMINFEKIEVVNRLRKEYVYETLRDYGVQYDKTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDEKMKDALQVDCTRYAPGIEIISVRVTKPTIPDRIRRNFEQMEEERTRVLIAIEKQKVAEKEAETSKKMAISEAEKNANVSKILMEQKLMGKDSARK 862
            H+I EGH+ VY+RGGALL + + PG+H+ LP IT +  VQ TLQTD+V ++PCGT GGVMI  ++IEVVN L    V++ +R+Y   YDKT I++KIHHE+NQFCS+H+LQ+VYI++FDQIDE +K ALQ D    APG+ I +VRVTKP IP+ IRRNFE ME E+T++LIA +KQKV EKEAET +K A+ EAEK A V+KI  +QK+M K++ ++
Sbjct:   24 HKIEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFRSVQTTLQTDEVKNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIELFDQIDENLKQALQKDLNTMAPGLTIQAVRVTKPKIPEAIRRNFELMEAEKTKLLIAAQKQKVVEKEAETERKRAVIEAEKIAQVAKIRFQQKVMEKETEKR 241          
BLAST of DY258625 vs. ExPASy Swiss-Prot
Match: ERLN1_PONAB (Erlin-1 OS=Pongo abelii GN=ERLIN1 PE=2 SV=2)

HSP 1 Score: 266.159 bits (679), Expect = 2.967e-70
Identity = 127/218 (58.26%), Postives = 169/218 (77.52%), Query Frame = 2
Query:  209 HQIPEGHVGVYWRGGALLETITHPGFHLKLPLITHYEPVQVTLQTDQVTDIPCGTKGGVMINFEKIEVVNRLRKEYVYETLRDYGVQYDKTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDEKMKDALQVDCTRYAPGIEIISVRVTKPTIPDRIRRNFEQMEEERTRVLIAIEKQKVAEKEAETSKKMAISEAEKNANVSKILMEQKLMGKDSARK 862
            H+I EGH+ VY+RGGALL + + PG+H+ LP IT +  VQ TLQTD+V ++PCGT GGVMI  ++IEVVN L    V++ +R+Y   YDKT I++KIHHE+NQFCS+H+LQ+VYI++FDQIDE +K ALQ D    APG+ I +VRVTKP IP+ IRRNFE ME E+T++LIA +KQKV EKEAET +K A+ EAEK A V+KI  +QK+M K++ ++
Sbjct:   24 HKIEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFRSVQTTLQTDEVKNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIELFDQIDENLKQALQKDLNLMAPGLTIQAVRVTKPKIPEAIRRNFELMEAEKTKLLIAAQKQKVVEKEAETERKKAVIEAEKIAQVAKIRFQQKVMEKETEKR 241          
BLAST of DY258625 vs. ExPASy Swiss-Prot
Match: ERLN1_HUMAN (Erlin-1 OS=Homo sapiens GN=ERLIN1 PE=1 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 2.967e-70
Identity = 127/218 (58.26%), Postives = 169/218 (77.52%), Query Frame = 2
Query:  209 HQIPEGHVGVYWRGGALLETITHPGFHLKLPLITHYEPVQVTLQTDQVTDIPCGTKGGVMINFEKIEVVNRLRKEYVYETLRDYGVQYDKTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDEKMKDALQVDCTRYAPGIEIISVRVTKPTIPDRIRRNFEQMEEERTRVLIAIEKQKVAEKEAETSKKMAISEAEKNANVSKILMEQKLMGKDSARK 862
            H+I EGH+ VY+RGGALL + + PG+H+ LP IT +  VQ TLQTD+V ++PCGT GGVMI  ++IEVVN L    V++ +R+Y   YDKT I++KIHHE+NQFCS+H+LQ+VYI++FDQIDE +K ALQ D    APG+ I +VRVTKP IP+ IRRNFE ME E+T++LIA +KQKV EKEAET +K A+ EAEK A V+KI  +QK+M K++ ++
Sbjct:   24 HKIEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFRSVQTTLQTDEVKNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIELFDQIDENLKQALQKDLNLMAPGLTIQAVRVTKPKIPEAIRRNFELMEAEKTKLLIAAQKQKVVEKEAETERKKAVIEAEKIAQVAKIRFQQKVMEKETEKR 241          
The following BLAST results are available for this feature:
BLAST of DY258625 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
ERLN2_RAT1.204e-7160.09Erlin-2 OS=Rattus norvegicus GN=Erlin2 PE=1 SV=1[more]
ERLN2_PONAB1.204e-7160.09Erlin-2 OS=Pongo abelii GN=ERLIN2 PE=2 SV=1[more]
ERLN2_MOUSE1.204e-7160.09Erlin-2 OS=Mus musculus GN=Erlin2 PE=1 SV=1[more]
ERLN2_HUMAN1.204e-7160.09Erlin-2 OS=Homo sapiens GN=ERLIN2 PE=1 SV=1[more]
ERLN2_BOVIN2.054e-7159.63Erlin-2 OS=Bos taurus GN=ERLIN2 PE=2 SV=1[more]
ERL2B_XENLA3.504e-7161.01Erlin-2-B OS=Xenopus laevis GN=erlin2-B PE=2 SV=1[more]
ERLN2_XENTR4.577e-7160.09Erlin-2 OS=Xenopus tropicalis GN=erlin2 PE=2 SV=1[more]
ERLN1_MOUSE2.271e-7058.26Erlin-1 OS=Mus musculus GN=Erlin1 PE=2 SV=1[more]
ERLN1_PONAB2.967e-7058.26Erlin-1 OS=Pongo abelii GN=ERLIN1 PE=2 SV=2[more]
ERLN1_HUMAN2.967e-7058.26Erlin-1 OS=Homo sapiens GN=ERLIN1 PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAI2CG07FM1 AbsDev1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY258625 ID=DY258625; Name=DY258625; organism=Citrus clementina; type=EST; length=1249bp
ATTCTCTCGCGCACATTTTGGCAACAGTTGAAACCCCGCCATGGATCCAC
AGCAACAAGGAGTAGGCGCTACACAGGCACAGCCTCGGCCTCAGCCTCAG
CCTGGCGATTCGTCTGCTATACTCGCCGTGTTCCTCACTTTCATCGCTAT
TGTCTCACTGATATTGATCCCATCATCGTCATCCATCAAAAGTAGCCTGG
CCATTTTGCACCAAATTCCAGAAGGCCACGTTGGAGTATATTGGAGAGGA
GGTGCCCTTCTAGAGACAATTACACACCCAGGCTTCCATCTGAAGTTGCC
TTTGATAACACACTACGAGCCTGTTCAAGTGACCCTTCAGACAGATCAGG
TTACTGACATTCCATGTGGGACCAAAGGGGGTGTAATGATCAACTTTGAG
AAGATAGAGGTTGTTAACCGGCTTCGTAAGGAATATGTGTACGAGACTCT
GCGCGACTATGGCGTGCAATATGACAAGACATGGATATATGACAAGATTC
ATCATGAGATCAATCAGTTCTGTAGTTCTCATAGTCTGCAACAAGTCTAT
ATTGATGTGTTTGATCAGATTGACGAAAAGATGAAGGATGCTCTTCAGGT
TGACTGCACGCGTTATGCTCCAGGCATTGAAATTATCAGTGTGCGTGTTA
CAAAGCCTACTATTCCAGATAGAATCAGAAGAAATTTTGAACAAATGGAA
GAGGAACGTACTAGGGTGTTAATTGCTATTGAGAAACAGAAAGTAGCTGA
GAAAGAGGCAGAGACAAGCAAAAAGATGGCTATCAGTGAAGCTGAGAAGA
ATGCCAATGTTAGCAAGATCCTTATGGAACAAAAGTTGATGGGAAAGGAC
AGTGCTCGGAAGCAAGAAGGAATTTGACAATCAAATGTAACTGGCTCGTC
AAAGGGGCCTGGCAAAAGCTGAATTCCTACCGCGAAATGGAAAAAAGCAA
AGGCAAACAACCTGAAGCTTAACCCCTGAATATCTTGAACTTGAAGTTTA
ATTGAGGCCCAAACTTAAAAAAACAAAAAAATTTCTTTTGGGGGAAAAGG
GGCCCAAACCAGGAATTTTTGAAAAAAAAAATTGCCAAGGGAAATTTCCC
CTTTAAAAAAATTCTTCCCAAAAAAAACACTCCTAATAAAGGGGGATTTT
GGCTAATAGCCTTATAAAAGGGGTTATGTTTTGTGGGGTAATTGTTTGGG
GGGGGTGGCCGCCGGATGAGGGGGGTGAGAAAAACCTCTTTCCGTGGTG
back to top