DY258699
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of DY258699 vs. ExPASy Swiss-Prot
Match: PGKH_ARATH (Phosphoglycerate kinase, chloroplastic OS=Arabidopsis thaliana GN=At1g56190 PE=1 SV=2) HSP 1 Score: 74.3294 bits (181), Expect = 1.381e-12 Identity = 37/41 (90.24%), Postives = 38/41 (92.68%), Query Frame = 1 Query: 1 KVGVAGVMSHISTGGGASLELLEGKELPGVVALDEATPVAV 123 KVGVAGVMSHISTGGGASLELLEGK LPGV+ALDEA PV V Sbjct: 438 KVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAIPVTV 478
BLAST of DY258699 vs. ExPASy Swiss-Prot
Match: PGKH_TOBAC (Phosphoglycerate kinase, chloroplastic OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 4.443e-11 Identity = 37/42 (88.10%), Postives = 38/42 (90.48%), Query Frame = 1 Query: 1 KVGVAGVMSHISTGGGASLELLEGKELPGVVALDEA-TPVAV 123 KVGVA VMSHISTGGGASLELLEGK LPGV+ALDEA PVAV Sbjct: 440 KVGVASVMSHISTGGGASLELLEGKVLPGVIALDEADAPVAV 481
BLAST of DY258699 vs. ExPASy Swiss-Prot
Match: PGKH_SPIOL (Phosphoglycerate kinase, chloroplastic (Fragment) OS=Spinacia oleracea PE=2 SV=2) HSP 1 Score: 68.1662 bits (165), Expect = 9.898e-11 Identity = 34/41 (82.93%), Postives = 37/41 (90.24%), Query Frame = 1 Query: 1 KVGVAGVMSHISTGGGASLELLEGKELPGVVALDEATPVAV 123 KVGVA MSHISTGGGASLELLEGK+LPGV+AL+EA PV V Sbjct: 393 KVGVAEAMSHISTGGGASLELLEGKQLPGVLALNEADPVPV 433 The following BLAST results are available for this feature:
BLAST of DY258699 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DY258699 ID=DY258699; Name=DY258699; organism=Citrus clementina; type=EST; length=1089bpback to top |