DY259731

Overview
NameDY259731
Unique NameDY259731
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length976
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14778 contig Ccv1_Contig14778:3..978. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY259731 vs. ExPASy Swiss-Prot
Match: UP12_ORYSJ (Unknown protein DS12 from 2D-PAGE of leaf, chloroplastic OS=Oryza sativa subsp. japonica GN=Os08g0242700 PE=2 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 8.361e-43
Identity = 90/191 (47.12%), Postives = 130/191 (68.06%), Query Frame = 1
Query:  298 SDQDADYIPMPHVLIDQDSNSDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGRKVEDPDLLERIRLTIINNLLKYHPESSEQLALGEAFGIKAPEKKLDVEIATHIHVKEEGPKRACL*KKPPIHLEYLEKT*KSLLEVMVDVESPKIDNKRIGSKKKFLVPNGGPPL 870
            S  + D +P P V+IDQDS+ DATIV+++ GDRLG L+DTMNALK+LGL+V K +V  + + K  K  IT+L TGRK+ +P+LLE +RLTIINN+++YHPE+S QLALG  FG + P + +DV+IATHI + ++GP R+ L  +       L    K + ++ + V+S + D + + +K KF V   G PL
Sbjct:   67 SSSNTDTVPTPKVIIDQDSDPDATIVEITLGDRLGDLLDTMNALKNLGLNVVKASVCLDSTGKHIKLAITKLSTGRKIGEPELLEAVRLTIINNMIQYHPEASSQLALGATFGPEPPTELVDVDIATHIDIYDDGPDRSLLVVETADRPGLLVDLVKIIDDINITVQSGEFDTEGLLAKAKFHVSYRGKPL 257          
BLAST of DY259731 vs. ExPASy Swiss-Prot
Match: UP12_ORYSI (Unknown protein DS12 from 2D-PAGE of leaf, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_027381 PE=1 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 8.361e-43
Identity = 90/191 (47.12%), Postives = 130/191 (68.06%), Query Frame = 1
Query:  298 SDQDADYIPMPHVLIDQDSNSDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGRKVEDPDLLERIRLTIINNLLKYHPESSEQLALGEAFGIKAPEKKLDVEIATHIHVKEEGPKRACL*KKPPIHLEYLEKT*KSLLEVMVDVESPKIDNKRIGSKKKFLVPNGGPPL 870
            S  + D +P P V+IDQDS+ DATIV+++ GDRLG L+DTMNALK+LGL+V K +V  + + K  K  IT+L TGRK+ +P+LLE +RLTIINN+++YHPE+S QLALG  FG + P + +DV+IATHI + ++GP R+ L  +       L    K + ++ + V+S + D + + +K KF V   G PL
Sbjct:   67 SSSNTDTVPTPKVIIDQDSDPDATIVEITLGDRLGDLLDTMNALKNLGLNVVKASVCLDSTGKHIKLAITKLSTGRKIGEPELLEAVRLTIINNMIQYHPEASSQLALGATFGPEPPTELVDVDIATHIDIYDDGPDRSLLVVETADRPGLLVDLVKIIDDINITVQSGEFDTEGLLAKAKFHVSYRGKPL 257          
The following BLAST results are available for this feature:
BLAST of DY259731 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
UP12_ORYSJ8.361e-4347.12Unknown protein DS12 from 2D-PAGE of leaf, chlorop... [more]
UP12_ORYSI8.361e-4347.12Unknown protein DS12 from 2D-PAGE of leaf, chlorop... [more]
back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YA09FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259731 ID=DY259731|Name=DY259731|organism=Citrus clementina|type=EST|length=976bp
AGGTTGCCAGTGCCACTGCTCTCTCCAGCTACGAGAAAGGCCCGAAAGCT
CTTCTTCAATTCGATGGCTTTTACAGCTACTCCTTTATTCTCTTCTACGG
CGTCGTCTTCTTCGACTGCTCTCCATCGATCTAAATTCCTTGATTCCGAT
TTTGCCGCTCCGTTTTCTCATGATTCATTTCATCTCATTAACTTCTCCCG
CAGATTTTCCGAACAAGGAATTTGTCTTTCGAGAAAAAAGAATATTTTGT
TTGCCTCTGTCAACGGTACGAATGCTGTGAGTCCAACCCCCTTGAAATCG
GACCAAGATGCTGATTACATTCCGATGCCACATGTTCTGATAGACCAGGA
TTCGAATTCTGATGCAACAATTGTGCAACTCAGTTTTGGAGATCGTCTTG
GAGCTCTCATTGACACGATGAATGCCCTGAAAGACTTGGGATTGGACGTG
GCTAAGGGAACTGTTAATACTGAAGGTTCAGTCAAACAGACAAAATTTTT
CATAACACGGTTAGACACCGGGCGCAAAGTTGAAGATCCTGACTTGCTAG
AGAGAATTCGACTTACCATCATTAACAATCTTTTGAAGTATCATCCAGAA
TCTAGCGAGCAACTTGCCCTGGGCGAGGCTTTCGGGATAAAAGCTCCAGA
GAAAAAGCTTGATGTTGAAATTGCCACCCATATACATGTCAAGGAGGAGG
GGCCTAAGAGAGCTTGCCTTTAAAAGAAACCGCCAATCCACCTGGAATAC
TTGGAAAAGACATGAAAATCCTTGCTCGAAGTTATGGTGGATGTTGAATC
CCCAAAAATTGATAACAAAAGGATTGGTTCCAAAAAAAAATTTCTGGTCC
CCAACGGGGGCCCACCATTAAACTTTTTTTGTCCCGGGGTGTGGGAACGG
GTCGGCAACCCCCTTTGAAGGGCCAAAAAGGAATTTGGCATTTTCCTAAT
CCATATTCAAAAAATTCCTTTTTGGC
back to top