DY259732

Overview
NameDY259732
Unique NameDY259732
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length907
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig470 contig Ccv1_Contig470:577..1483. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY259732 vs. ExPASy Swiss-Prot
Match: AB11G_ARATH (ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 4.819e-58
Identity = 101/203 (49.75%), Postives = 147/203 (72.41%), Query Frame = 3
Query:    3 VFERERLNGHYGATAFVFGNTFSALPYLALISLIPGAIVYDLPGLHKGYQHFTYFVLLLFACMLLVESLMMIVASLVPNYLTGIITGAGIQGLMILGGGFFRLPNDLPHPFWKYPLYYIAFHKYAYQGMFKNEFEGLKFDN-----NLDGEQVLRDNWQLQMGYSKWVDLAILFGMVVFYRLVFLGIVKTVEKMKPVVKAFMS 596
            VF+RERLNGHYG  AFV  NT SA P+L +I+ I G I Y + GLH G+ H+ +FVL L+A + +VESLMM +AS+VPN+L GII GAGIQG+ +L  GFFRLPND+P PFW+YP+ YI+FH +A QG ++N+  GL FD+      + GE VL + +Q+ +  SKW++L+++  M++ YR++F  ++KT E + P V+ +++
Sbjct:  461 VFQRERLNGHYGVAAFVIANTLSATPFLIMITFISGTICYFMVGLHPGFTHYLFFVLCLYASVTVVESLMMAIASIVPNFLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLRGLTFDSQGSAFKIPGEYVLENVFQIDLHRSKWINLSVILSMIIIYRIIFFIMIKTNEDVTPWVRGYIA 663          
BLAST of DY259732 vs. ExPASy Swiss-Prot
Match: AB15G_ARATH (ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2)

HSP 1 Score: 182.956 bits (463), Expect = 2.100e-45
Identity = 89/215 (41.40%), Postives = 143/215 (66.51%), Query Frame = 3
Query:    3 VFERERLNGHYGATAFVFGNTFSALPYLALISLIPGAIVYDLPGLHKGYQHFTYFVLLLFACMLLVESLMMIVASLVPNYLTGIITGAGIQGLMILGGGFFRLPNDLPHPFWKYPLYYIAFHKYAYQGMFKNEFEGLKF------DNNLDGEQVLRDNWQLQMGYSKWVDLAILFGMVVFYRLVFLGIVKTVEKMKPVVKAFMSVPMKRTTQIME 629
            VF +ERL+G+YG + ++  N  S+ P+L  IS+I G I Y+L     G+ H+ +F L +F  + ++ESLMM+VAS+VPN+L G+ITGAG+ G++++  GFFRL  DLP  FW+YP+ YI++  +A QG +KN+F GL+F      +  + GE+V+   + +++ YSKW DLA +  ++V YRL+F  ++K  E+  P +KA   +  KRT + ++
Sbjct:  439 VFYKERLSGYYGVSVYILSNYISSFPFLVAISVITGTITYNLVKFRPGFSHYAFFCLNIFFSVSVIESLMMVVASVVPNFLMGLITGAGLIGIIMMTSGFFRLLPDLPKIFWRYPVSYISYGSWAIQGGYKNDFLGLEFEPLFPGEPKMTGEEVIEKVFGVKVTYSKWWDLAAVVAILVCYRLLFFVVLKLRERAGPALKA---IQAKRTMRNLD 650          
BLAST of DY259732 vs. ExPASy Swiss-Prot
Match: AB12G_ARATH (ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 7.979e-45
Identity = 88/215 (40.93%), Postives = 144/215 (66.98%), Query Frame = 3
Query:    3 VFERERLNGHYGATAFVFGNTFSALPYLALISLIPGAIVYDLPGLHKGYQHFTYFVLLLFACMLLVESLMMIVASLVPNYLTGIITGAGIQGLMILGGGFFRLPNDLPHPFWKYPLYYIAFHKYAYQGMFKNEFEGLKFD------NNLDGEQVLRDNWQLQMGYSKWVDLAILFGMVVFYRLVFLGIVKTVEKMKPVVKAFMSVPMKRTTQIME 629
            VF +ERL+G+YG + ++  N  S+ P+L  I+LI G+I Y++     G  H+ +F L +F  + ++ESLMM+VASLVPN+L G+ITGAGI G++++  GFFRL  DLP  FW+YP+ ++++  +A QG +KN+F GL+FD        + GEQV+   + +Q+ +SKW DL+ +  ++V YR++F  ++K  E+ +P +KA   +  KRT + ++
Sbjct:  440 VFYKERLSGYYGVSVYIISNYVSSFPFLVAIALITGSITYNMVKFRPGVSHWAFFCLNIFFSVSVIESLMMVVASLVPNFLMGLITGAGIIGIIMMTSGFFRLLPDLPKVFWRYPISFMSYGSWAIQGAYKNDFLGLEFDPMFAGEPKMTGEQVINKIFGVQVTHSKWWDLSAIVLILVCYRILFFIVLKLKERAEPALKA---IQAKRTMKSLK 651          
BLAST of DY259732 vs. ExPASy Swiss-Prot
Match: AB13G_ARATH (ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 6.543e-39
Identity = 81/199 (40.70%), Postives = 120/199 (60.30%), Query Frame = 3
Query:    3 VFERERLNGHYGATAFVFGNTFSALPYLALISLIPGAIVYDLPGLHKGYQHFTYFVLLLFACMLLVESLMMIVASLVPNYLTGIITGAGIQGLMILGGGFFRLPNDLPHPFWKYPLYYIAFHKYAYQGMFKNEFEGLKFDN------NLDGEQVLRDNWQLQMGYSKWVDLAILFGMVVFYRLVFLGIVKTVEKMKPVV 581
            VF RERLNGHYG   +   N  S+LP++ L+ L   +I   +     G  HF Y  L L   +  VES MM++AS+VPN+L G++ GAG  G+M+L  GFFR   DLP  FW+YP+ YI +  +A QG +KNE  G+++D+       + GE +L+    +    SKW+DLA++  +++ YR+ F  I+K  EK+ PV+
Sbjct:  434 VFSRERLNGHYGVAVYTVSNLLSSLPFIILMCLSTSSITIYMVRFQSGGSHFFYNCLDLICAITTVESCMMMIASVVPNFLMGVMLGAGYIGIMVLSAGFFRFFPDLPMVFWRYPVSYINYGAWALQGAYKNEMIGVEYDSPLPLVPKMKGELILQTVLGINPESSKWLDLAVVMMILIGYRIAFFAILKFREKVFPVI 632          
BLAST of DY259732 vs. ExPASy Swiss-Prot
Match: AB3G_ARATH (ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 9.172e-25
Identity = 58/183 (31.69%), Postives = 97/183 (53.01%), Query Frame = 3
Query:    3 VFERERLNGHYGATAFVFGNTFSALPYLALISLIPGAIVYDLPGLHKGYQHFTYFVLLLFACMLLVESLMMIVASLVPNYLTGIITGAGIQGLMILGGGFFRLPNDLPHPFWKYPLYYIAFHKYAYQGMFKNEFEGLKFD----NNLDGEQVLRDNWQLQMG-YSKWVDLAILFGMVVFYRLV 536
            ++  E  N H GA  F+ G    ++P+L L+S+    + Y + GL   +    YFVL  F C+L+ E LM+ +A +  +     +T   +  +M+L  G FR+   LP P W YP  YI+FH Y+ +G+ +NE+ G  F      ++ G Q ++ N+Q+     +KW ++ +L  M   YRL+
Sbjct:  491 IYRSEASNQHSGAFVFLLGQFLGSIPFLFLMSISSSLVFYFMVGLRDDFSLLMYFVLNFFMCLLVNEGLMLFIACIWRDVYWSTLTLISVHVIMMLAAGHFRIRTALPKPVWTYPFAYISFHTYSIEGLLENEYLGEVFAVGEVRSISGYQAIQGNYQISPDTNAKWRNMLVLLAMAFGYRLL 673          
BLAST of DY259732 vs. ExPASy Swiss-Prot
Match: AB23G_ARATH (ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.160e-17
Identity = 50/191 (26.18%), Postives = 106/191 (55.50%), Query Frame = 3
Query:    3 VFERERLNGHYGATAFVFGNTFSALPYLALISLIPGAIVYDLPGLHKGYQHFTYFVLLLFACMLLVESLMMIVASLVPNYLTGIITGAGIQGLMILGGGFFRLPNDLPHPFWKYPLYYIAFHKYAYQGMFKNEFEGLK---FDNN-----LDGEQVLRDNWQLQMGYSKWVDLAILFGMVVFYRLVFLGIV 551
            V  +E   G Y  ++++  NT + +P+L ++SL+    VY + GL+   Q F++FVL ++  +L+  SL++ ++++ P++++G      + G   L  G+F     +P P W + +YY++ ++Y  + M  NE+  ++   F +      + GE VL++    +   ++W+++ I+    VFYR++  GI+
Sbjct:  429 VLMKESSRGSYRISSYMIANTIAFVPFLFVVSLLFSIPVYWIVGLNPSIQAFSFFVLCVWLIILMASSLVLFLSAVSPDFISGNSLICTVLGAFFLFSGYFIPKEKIPKP-WMF-MYYVSLYRYPLESMVVNEYWSMREECFSSGNMGCLMTGEDVLKERGLDK--DTRWINVGIMLAFFVFYRILCWGIL 615          
BLAST of DY259732 vs. ExPASy Swiss-Prot
Match: AB8G_ARATH (ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.201e-16
Identity = 60/200 (30.00%), Postives = 97/200 (48.50%), Query Frame = 3
Query:   12 RERLNGHYGATAFVFGNTFSALPYLALISLIPGAIVYDLPGLHKGYQHFTYFVLLLFACMLLVESLMMIVASLVPNYLTGIITGAGIQGLMILGGGFFRLPNDLPHPFWKYPLYYIAFHKYAYQGMFKNEFEGLKFD------------NNLDGEQVLRDNWQLQMGYSKWVDLAILFGMVVFYR-LVFLGIVKTVEKMK 572
            RE  +G Y  ++ +  NT   LPYL +IS+I    VY L GL   +Q F YFVL+++  +L+  S ++ ++SL PNY+TG      +     L  G+F     LP  +W + +Y+ + +KYA   +  NE+  L                 + G  VL+     +    +W ++ +L G  V YR L FL +++ V   K
Sbjct:  393 RETSSGIYRLSSHILANTLVFLPYLFVISIIYSVSVYFLIGLCPTWQAFGYFVLVIWIILLMANSFVLFLSSLAPNYITGTSLVTILLAAFFLFSGYFISKESLP-KYWLF-MYFFSMYKYALDALLINEYSCLASKCLVWLEEAQTKICMVTGGDVLKKKGLHEK--QRWFNVYVLLGFFVLYRVLCFLALLRRVSGSK 588          
BLAST of DY259732 vs. ExPASy Swiss-Prot
Match: AB4G_ARATH (ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.959e-16
Identity = 60/200 (30.00%), Postives = 98/200 (49.00%), Query Frame = 3
Query:   12 RERLNGHYGATAFVFGNTFSALPYLALISLIPGAIVYDLPGLHKGYQHFTYFVLLLFACMLLVESLMMIVASLVPNYLTGIITGAGIQGLMILGGGFFRLPNDLPHPFWKYPLYYIAFHKYAYQGMFKNEFEGLK------FDNN------LDGEQVLRDNWQLQMGYSKWVDLAILFGMVVFYR-LVFLGIVKTVEKMK 572
            RE  +G Y  ++ +  NT   LPYL LI++I    +Y L GL   +Q   YFVL+++  +L+  S ++ ++SL PNY+ G  +   +     L  G+F     LP  +W + +Y+ + +KYA   +  NE+  L       F+        + G  VL  N   +    +W ++ +L G  V YR L FL ++K V   K
Sbjct:  381 RETSSGLYRLSSHILANTLVFLPYLLLIAIIYSVSLYFLVGLCFSWQALAYFVLVIWIIVLMANSFVLFLSSLAPNYIAGTSSVTILLAAFFLFSGYFISKESLP-KYWLF-MYFFSMYKYALDALLINEYSCLHNKCLVWFEEASVNSCLVTGGDVLDKNGLHER--QRWFNVYMLLGFFVLYRVLCFLVLLKRVSGSK 576          
BLAST of DY259732 vs. ExPASy Swiss-Prot
Match: AB10G_ARATH (ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.124e-14
Identity = 48/178 (26.97%), Postives = 93/178 (52.25%), Query Frame = 3
Query:    3 VFERERLNGHYGATAFVFGNTFSALPYLALISLIPGAIVYDLPGLHKGYQHFTYFVLLLFACMLLVESLMMIVASLVPNYLTGIITGAGIQGLMILGGGFFRLPNDLPHPFWKYPLYYIAFHKYAYQGMFKNEFEGLKFDNNLDGEQVLRDNWQLQMGYSKWVDLAILFGMVVFYRLV 536
            +  RE     Y   ++V  +T   +P+L +IS++    VY L GL +    F YF L+++  +L+  S +   ++LVPN++ G    +G+ G   L  G+F   + +P  +W++ ++Y++  KY ++ +  NE+ G  F      +Q L+++        KW +L I+   +V YR++
Sbjct:  412 ILMRETSRRAYRVLSYVLADTLIFIPFLLIISMLFATPVYWLVGLRRELDGFLYFSLVIWIVLLMSNSFVACFSALVPNFIMGTSVISGLMGSFFLFSGYFIAKDRIP-VYWEF-MHYLSLFKYPFECLMINEYRGDVFLK----QQDLKES-------QKWSNLGIMASFIVGYRVL 576          
BLAST of DY259732 vs. ExPASy Swiss-Prot
Match: AB5G_ARATH (ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.623e-13
Identity = 48/193 (24.87%), Postives = 100/193 (51.81%), Query Frame = 3
Query:    3 VFERERLNGHYGATAFVFGNTFSALPYLALISLIPGAIVYDLPGLHKGYQHFTYFVLLLFACMLLVESLMMIVASLVPNYLTGIITGAGIQGLMILGGGFFRLPNDLPHPFWKYPLYYIAFHKYAYQGMFKNEFEGLKFDNNLD---------GEQVLRDNWQLQMGYSKWVDLAILFGMVVFYRLVFLGIVK 554
            +  +E  +G Y  +++   N    LP+L +++++    VY L GL+  +  F +F LL++  +    S+++  ++LVPN++ G    +G+ G   L  G+F   +++P  +W + ++YI+  KY ++G   NEF   K +  L+          E +L++  +     S+W ++ I+   V+ YR +   I++
Sbjct:  450 ILMKETSSGSYRVSSYAVANGLVYLPFLLILAILFSTPVYWLVGLNPSFMAFLHFSLLIWLILYTANSVVVCFSALVPNFIVGNSVISGVMGSFFLFSGYFISNHEIP-GYWIF-MHYISLFKYPFEGFLINEFS--KSNKCLEYGFGKCLVTEEDLLKE--ERYGEESRWRNVVIMLCFVLLYRFISYVILR 636          
The following BLAST results are available for this feature:
BLAST of DY259732 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
AB11G_ARATH4.819e-5849.75ABC transporter G family member 11 OS=Arabidopsis ... [more]
AB15G_ARATH2.100e-4541.40ABC transporter G family member 15 OS=Arabidopsis ... [more]
AB12G_ARATH7.979e-4540.93ABC transporter G family member 12 OS=Arabidopsis ... [more]
AB13G_ARATH6.543e-3940.70ABC transporter G family member 13 OS=Arabidopsis ... [more]
AB3G_ARATH9.172e-2531.69ABC transporter G family member 3 OS=Arabidopsis t... [more]
AB23G_ARATH3.160e-1726.18ABC transporter G family member 23 OS=Arabidopsis ... [more]
AB8G_ARATH1.201e-1630.00ABC transporter G family member 8 OS=Arabidopsis t... [more]
AB4G_ARATH5.959e-1630.00ABC transporter G family member 4 OS=Arabidopsis t... [more]
AB10G_ARATH1.124e-1426.97ABC transporter G family member 10 OS=Arabidopsis ... [more]
AB5G_ARATH1.623e-1324.87ABC transporter G family member 5 OS=Arabidopsis t... [more]
back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YA10FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259732 ID=DY259732|Name=DY259732|organism=Citrus clementina|type=EST|length=907bp
AGGTATTTGAGCGAGAGAGACTAAACGGGCACTATGGTGCTACTGCGTTT
GTGTTTGGCAACACGTTTTCTGCGCTGCCATACTTAGCTCTCATTTCATT
GATTCCTGGAGCGATAGTGTATGACCTTCCGGGACTTCACAAAGGATATC
AACACTTCACATACTTTGTTTTGTTATTGTTTGCTTGCATGTTGCTCGTT
GAGAGCCTAATGATGATCGTTGCAAGCTTGGTGCCCAACTATCTGACGGG
CATAATAACAGGAGCTGGAATTCAAGGCCTTATGATATTAGGCGGCGGAT
TTTTTCGATTGCCAAATGATCTTCCTCATCCATTTTGGAAATACCCATTA
TATTATATTGCTTTCCACAAATATGCGTATCAAGGAATGTTCAAGAACGA
GTTTGAAGGTCTGAAATTTGACAACAATCTAGATGGTGAGCAGGTTTTGA
GAGATAATTGGCAACTGCAAATGGGATATTCTAAGTGGGTTGATCTTGCT
ATCTTGTTTGGTATGGTGGTTTTTTATCGACTTGTATTCTTGGGAATCGT
CAAGACAGTTGAAAAGATGAAGCCTGTGGTTAAAGCTTTTATGTCTGTGC
CCATGAAACGAACAACTCAAATCATGGAAAATCCGTATACTACACCTCCA
CAAGAAAACAAAATACTTTACAAGTGATCGTGAACAAAAGACTTCGGATA
TTCGTTAGTTCAGCTAGTAAAATCGCTTGGAAATAGGTGAAAAAACTATG
TTCCCATGAATGGAAAAAGAATGATGTAATTAAAAAAGAATATTTTACCT
TTGAAACATCCTTTAAACACCTTTATTTTTGGATGAACCAGAATTGCTTC
CTTATTATCTTTAATTTTTATTTTGTTGACCACAATTAAAAAAGTTTCCA
TTAACCC
back to top