DY259733

Overview
NameDY259733
Unique NameDY259733
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length992
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY259733 vs. ExPASy Swiss-Prot
Match: CALR3_ARATH (Calreticulin-3 OS=Arabidopsis thaliana GN=CRT3 PE=2 SV=2)

HSP 1 Score: 441.039 bits (1133), Expect = 5.381e-141
Identity = 198/249 (79.52%), Postives = 224/249 (89.96%), Query Frame = 2
Query:    2 IFFEERFDHGWRSPWVISDWKPSEGKAGYFKPTAGKWHGDPDDKGIQTPTDARHYAISAKIPEFSNKNRTLVVQYSIRFEQDIECGGGYIKLLSAYVNQKKFGGDAPYSLMFGPDICGTQKKHLHVILSYQGQNYPIKKELECETDKLTHFYTFILRPDASYSILIDNRERDSGSMYTDWDILPPRKIKAVNAKKPADWDDREYIDDPNAVKPEGYDSIPKEIPDPXAKKPDNWDEDEDGLWKPPRYPS 748
            IF EE F+ GW+S WV+SDWK +EGKAG FK TAGKW GDPD+KGIQT  DA+HYAISAKIPEFSNKNRTLVVQYS++ EQDIECGG YIKLLS YVNQK+FGGD PYSLMFGPDICGTQ K LHVI+SYQGQNYPIKK+L+CETDKL HFYTFILRPDASYS+L+DN+ER+ GSMYTDWDILPPRKIK  NAKKP DWDDREYIDDPN VKPEG+DSIP+EIPD  AK+P++WDE+E+GLW+PP+ P+
Sbjct:   30 IFLEEHFEGGWKSRWVLSDWKRNEGKAGTFKHTAGKWPGDPDNKGIQTYNDAKHYAISAKIPEFSNKNRTLVVQYSVKIEQDIECGGAYIKLLSGYVNQKQFGGDTPYSLMFGPDICGTQTKKLHVIVSYQGQNYPIKKDLQCETDKLNHFYTFILRPDASYSVLVDNKEREFGSMYTDWDILPPRKIKVKNAKKPEDWDDREYIDDPNDVKPEGFDSIPREIPDRKAKEPEDWDEEENGLWEPPKIPN 278          

HSP 2 Score: 83.1889 bits (204), Expect = 5.381e-141
Identity = 35/79 (44.30%), Postives = 55/79 (69.62%), Query Frame = 3
Query:  732 PQDTHPRYKGLWRPQRIKNPNYKGKWKIPYIDHPKF*KDPNPFLLSPLSM*AMKFWPGQAGSVYNTFLTRDDPAKAKTL 968
            P+  +  YKG W+ +RIKNPNYKGKWK P+ID+P+F  DP+ ++L  +    ++ W  +AGS+++  L  DDPA A+++
Sbjct:  274 PKIPNSAYKGPWKAKRIKNPNYKGKWKNPWIDNPEFEDDPDLYVLKSIKYAGIEVWQVKAGSIFDNILICDDPAYARSI 352          
BLAST of DY259733 vs. ExPASy Swiss-Prot
Match: CALR_BERST (Calreticulin OS=Berberis stolonifera PE=2 SV=1)

HSP 1 Score: 357.836 bits (917), Expect = 9.312e-115
Identity = 163/250 (65.20%), Postives = 195/250 (78.00%), Query Frame = 2
Query:    2 IFFEERFDHGWRSPWVISDWKPSEGKAGYFKPTAGKWHGDPDDKGIQTPTDARHYAISAKIPEFSNKNRTLVVQYSIRFEQDIECGGGYIKLLSAYVNQKKFGGDAPYSLMFGPDICGTQKKHLHVILSYQGQNYPIKKELECETDKLTHFYTFILRPDASYSILIDNRERDSGSMYTDWDILPPRKIKAVNAKKPADWDDREYIDDPNAVKPEGYDSIPKEIPDPXAKKPDNWDEDEDGLWKPPRYPSP 751
            +FFEERF+ GW S WV SDWK  E  AG +  T+GKW+GD +DKGIQT  D R YAISA  PEFSNK +TLV Q+S++ EQ ++CGGGY+KLLS  V+QKKFGGD PYS+MFGPDICG   K +H IL+    N+ IKK++ CETD+LTH YTFILRPDASYSILIDN E+ SGS+YTDWDILPP++IK   AKKP DW+D+EYI DP   KPEGYD IPKEI DP AKKP++WD++EDG W  P  P+P
Sbjct:   24 VFFEERFEDGWESKWVKSDWKRDENMAGEWNFTSGKWNGDANDKGIQTSEDYRFYAISAAFPEFSNKGKTLVFQFSVKHEQKLDCGGGYMKLLSGDVDQKKFGGDTPYSIMFGPDICGYSTKKVHAILTKGETNHLIKKDVPCETDQLTHVYTFILRPDASYSILIDNVEKQSGSVYTDWDILPPKQIKDPEAKKPEDWEDKEYIPDPEDKKPEGYDDIPKEITDPEAKKPEDWDDEEDGEWTAPTIPNP 273          

HSP 2 Score: 78.9518 bits (193), Expect = 9.312e-115
Identity = 34/79 (43.04%), Postives = 51/79 (64.56%), Query Frame = 3
Query:  732 PQDTHPRYKGLWRPQRIKNPNYKGKWKIPYIDHPKF*KDPNPFLLSPLSM*AMKFWPGQAGSVYNTFLTRDDPAKAKTL 968
            P   +P YKG W+P++IKNPN+KGKWK P ID+P F  DP+ ++   L    ++ W  ++G++++  L  DDP  AK L
Sbjct:  268 PTIPNPDYKGEWKPKKIKNPNFKGKWKAPMIDNPDFKDDPDIYVFPKLKYVGIELWQVKSGTMFDNVLICDDPDYAKKL 346          
BLAST of DY259733 vs. ExPASy Swiss-Prot
Match: CALR_PRUAR (Calreticulin OS=Prunus armeniaca PE=2 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 1.215e-114
Identity = 159/250 (63.60%), Postives = 196/250 (78.40%), Query Frame = 2
Query:    2 IFFEERFDHGWRSPWVISDWKPSEGKAGYFKPTAGKWHGDPDDKGIQTPTDARHYAISAKIPEFSNKNRTLVVQYSIRFEQDIECGGGYIKLLSAYVNQKKFGGDAPYSLMFGPDICGTQKKHLHVILSYQGQNYPIKKELECETDKLTHFYTFILRPDASYSILIDNRERDSGSMYTDWDILPPRKIKAVNAKKPADWDDREYIDDPNAVKPEGYDSIPKEIPDPXAKKPDNWDEDEDGLWKPPRYPSP 751
            +FFEERF+ GW   WV S+WK  E  AG +  T+GKW+GDP+DKGIQT  D R YAISA+ PEFSNK++TLV Q+S++ EQ ++CGGGYIKLLS  V+QKKFGGD PYS+MFGPDICG   K +H IL+Y   N  IKK++ CETD+LTH YTFI+RPDA+YSILIDN E+ +GS+Y+DWD+LP +KIK   AKKP DW+D+EYI DP   KPEGYD IPKEI DP AKKP++WD++EDG W  P  P+P
Sbjct:   26 VFFEERFEDGWDKRWVTSEWKKDENLAGEWNYTSGKWNGDPNDKGIQTSEDYRFYAISAEFPEFSNKDKTLVFQFSVKHEQKLDCGGGYIKLLSGDVDQKKFGGDTPYSIMFGPDICGYSTKKVHAILNYNNTNNLIKKDVPCETDQLTHVYTFIIRPDATYSILIDNLEKQTGSLYSDWDLLPAKKIKDPEAKKPEDWEDQEYIPDPEDKKPEGYDDIPKEITDPDAKKPEDWDDEEDGEWTAPTIPNP 275          

HSP 2 Score: 79.337 bits (194), Expect = 1.215e-114
Identity = 33/79 (41.77%), Postives = 51/79 (64.56%), Query Frame = 3
Query:  732 PQDTHPRYKGLWRPQRIKNPNYKGKWKIPYIDHPKF*KDPNPFLLSPLSM*AMKFWPGQAGSVYNTFLTRDDPAKAKTL 968
            P   +P YKG W+P++IKNPN+KGKWK P ID+P+F  DP  ++   L    ++ W  ++G++++  L  D+P  AK L
Sbjct:  270 PTIPNPEYKGEWKPKKIKNPNFKGKWKAPLIDNPEFKDDPELYVYPNLKYVGIELWQVKSGTLFDNILITDEPEYAKQL 348          
BLAST of DY259733 vs. ExPASy Swiss-Prot
Match: CALR_NICPL (Calreticulin OS=Nicotiana plumbaginifolia GN=CAL1 PE=2 SV=1)

HSP 1 Score: 355.14 bits (910), Expect = 2.069e-114
Identity = 158/250 (63.20%), Postives = 196/250 (78.40%), Query Frame = 2
Query:    2 IFFEERFDHGWRSPWVISDWKPSEGKAGYFKPTAGKWHGDPDDKGIQTPTDARHYAISAKIPEFSNKNRTLVVQYSIRFEQDIECGGGYIKLLSAYVNQKKFGGDAPYSLMFGPDICGTQKKHLHVILSYQGQNYPIKKELECETDKLTHFYTFILRPDASYSILIDNRERDSGSMYTDWDILPPRKIKAVNAKKPADWDDREYIDDPNAVKPEGYDSIPKEIPDPXAKKPDNWDEDEDGLWKPPRYPSP 751
            +FFEE F+ GW S WV S+WK  E  AG +  T+GKW+GD +DKGIQT  D R YAISA+ PEFSNK + LV Q+S++ EQ ++CGGGY+KLLS  V+QKKFGGD PYS+MFGPDICG   K +H IL+Y   N+ IKKE+ CETD+LTH YTFILRPDA+YSILIDN E+ SGS+Y+DWD+LPP+ IK  +AKKP DWD++E+IDDP   KPEGYD IP+EI DP AKKP++WD++EDG W  P  P+P
Sbjct:   29 VFFEESFNDGWESRWVKSEWKKDENMAGEWNHTSGKWNGDANDKGIQTSEDYRFYAISAEFPEFSNKGKNLVFQFSVKHEQKLDCGGGYMKLLSGDVDQKKFGGDTPYSIMFGPDICGYSTKKVHAILTYNDTNHLIKKEVPCETDQLTHVYTFILRPDATYSILIDNVEKQSGSLYSDWDLLPPKTIKDPSAKKPEDWDEKEFIDDPEDKKPEGYDDIPEEITDPDAKKPEDWDDEEDGEWTAPTIPNP 278          

HSP 2 Score: 80.4925 bits (197), Expect = 2.069e-114
Identity = 33/79 (41.77%), Postives = 51/79 (64.56%), Query Frame = 3
Query:  732 PQDTHPRYKGLWRPQRIKNPNYKGKWKIPYIDHPKF*KDPNPFLLSPLSM*AMKFWPGQAGSVYNTFLTRDDPAKAKTL 968
            P   +P YKG W+P++IKNPNYKGKWK P ID+P F  DP+ ++   L    ++ W  ++G++++  +  DDP  AK +
Sbjct:  273 PTIPNPEYKGPWKPKKIKNPNYKGKWKAPLIDNPDFKDDPDLYVFPKLKYVGVELWQVKSGTLFDNIVICDDPEYAKAI 351          
BLAST of DY259733 vs. ExPASy Swiss-Prot
Match: CALR2_ARATH (Calreticulin-2 OS=Arabidopsis thaliana GN=CRT2 PE=1 SV=3)

HSP 1 Score: 355.14 bits (910), Expect = 1.021e-113
Identity = 157/250 (62.80%), Postives = 197/250 (78.80%), Query Frame = 2
Query:    2 IFFEERFDHGWRSPWVISDWKPSEGKAGYFKPTAGKWHGDPDDKGIQTPTDARHYAISAKIPEFSNKNRTLVVQYSIRFEQDIECGGGYIKLLSAYVNQKKFGGDAPYSLMFGPDICGTQKKHLHVILSYQGQNYPIKKELECETDKLTHFYTFILRPDASYSILIDNRERDSGSMYTDWDILPPRKIKAVNAKKPADWDDREYIDDPNAVKPEGYDSIPKEIPDPXAKKPDNWDEDEDGLWKPPRYPSP 751
            + FEERFD GW + WV S+WK  +  AG +K TAG W GD +DKGIQT  D R YAISA+ PEFSNK++TLV Q+S++ EQ ++CGGGY+KLLS  V+QKKFGGD PYS+MFGPDICG   K +H IL+Y   N+ IKK++ CETD+LTH YTFILRPDA+YSILIDN E+ +GS+Y+DWD+LPP+KIK  +AKKP DWD++EYI DP   KP+GYD IPKEIPD  +KKP++WD++EDG W  P  P+P
Sbjct:   24 VIFEERFDDGWENRWVKSEWKKDDNTAGEWKHTAGNWSGDANDKGIQTSEDYRFYAISAEFPEFSNKDKTLVFQFSVKHEQKLDCGGGYMKLLSGDVDQKKFGGDTPYSIMFGPDICGYSTKKVHAILTYNEANHLIKKDVPCETDQLTHVYTFILRPDATYSILIDNVEKQTGSLYSDWDLLPPKKIKDPSAKKPEDWDEQEYISDPEDKKPDGYDDIPKEIPDTDSKKPEDWDDEEDGEWTAPTIPNP 273          

HSP 2 Score: 78.1814 bits (191), Expect = 1.021e-113
Identity = 34/79 (43.04%), Postives = 49/79 (62.03%), Query Frame = 3
Query:  732 PQDTHPRYKGLWRPQRIKNPNYKGKWKIPYIDHPKF*KDPNPFLLSPLSM*AMKFWPGQAGSVYNTFLTRDDPAKAKTL 968
            P   +P Y G W+P++IKNPNYKGKW+ P ID+P F  DP  ++   L    ++ W  ++GS+++  L  DDP  AK L
Sbjct:  268 PTIPNPEYMGEWKPKQIKNPNYKGKWEAPLIDNPDFKDDPELYVFPKLKYVGLELWQVKSGSLFDNVLICDDPDYAKKL 346          
BLAST of DY259733 vs. ExPASy Swiss-Prot
Match: CALR1_ARATH (Calreticulin-1 OS=Arabidopsis thaliana GN=CRT1 PE=1 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 1.332e-113
Identity = 157/250 (62.80%), Postives = 194/250 (77.60%), Query Frame = 2
Query:    2 IFFEERFDHGWRSPWVISDWKPSEGKAGYFKPTAGKWHGDPDDKGIQTPTDARHYAISAKIPEFSNKNRTLVVQYSIRFEQDIECGGGYIKLLSAYVNQKKFGGDAPYSLMFGPDICGTQKKHLHVILSYQGQNYPIKKELECETDKLTHFYTFILRPDASYSILIDNRERDSGSMYTDWDILPPRKIKAVNAKKPADWDDREYIDDPNAVKPEGYDSIPKEIPDPXAKKPDNWDEDEDGLWKPPRYPSP 751
            + FEE+F+ GW   WV SDWK  +  AG +K TAG W GD +DKGIQT  D R YAISA+ PEFSNK++TLV Q+S++ EQ ++CGGGY+KLLS  V+Q KFGGD PYS+MFGPDICG   K +H IL+Y G N+ IKKE+ CETD+LTH YTF+LRPDA+YSILIDN E+ +GS+Y+DWD+LP +KIK  +AKKP DWDD+EYI DP   KP GYD IPKEIPD  AKKP++WD++EDG W  P  P+P
Sbjct:   24 VIFEEKFEDGWEKRWVKSDWKKDDNTAGEWKHTAGNWSGDANDKGIQTSEDYRFYAISAEFPEFSNKDKTLVFQFSVKHEQKLDCGGGYMKLLSDDVDQTKFGGDTPYSIMFGPDICGYSTKKVHAILTYNGTNHLIKKEVPCETDQLTHVYTFVLRPDATYSILIDNVEKQTGSLYSDWDLLPAKKIKDPSAKKPEDWDDKEYIPDPEDTKPAGYDDIPKEIPDTDAKKPEDWDDEEDGEWTAPTIPNP 273          

HSP 2 Score: 79.337 bits (194), Expect = 1.332e-113
Identity = 34/79 (43.04%), Postives = 49/79 (62.03%), Query Frame = 3
Query:  732 PQDTHPRYKGLWRPQRIKNPNYKGKWKIPYIDHPKF*KDPNPFLLSPLSM*AMKFWPGQAGSVYNTFLTRDDPAKAKTL 968
            P   +P Y G W+P++IKNP YKGKWK P ID+P+F  DP  ++   L    ++ W  ++GS+++  L  DDP  AK L
Sbjct:  268 PTIPNPEYNGEWKPKKIKNPAYKGKWKAPMIDNPEFKDDPELYVFPKLKYVGVELWQVKSGSLFDNVLVSDDPEYAKKL 346          
BLAST of DY259733 vs. ExPASy Swiss-Prot
Match: CALR_BETVU (Calreticulin OS=Beta vulgaris PE=2 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 1.738e-113
Identity = 157/250 (62.80%), Postives = 194/250 (77.60%), Query Frame = 2
Query:    2 IFFEERFDHGWRSPWVISDWKPSEGKAGYFKPTAGKWHGDPDDKGIQTPTDARHYAISAKIPEFSNKNRTLVVQYSIRFEQDIECGGGYIKLLSAYVNQKKFGGDAPYSLMFGPDICGTQKKHLHVILSYQGQNYPIKKELECETDKLTHFYTFILRPDASYSILIDNRERDSGSMYTDWDILPPRKIKAVNAKKPADWDDREYIDDPNAVKPEGYDSIPKEIPDPXAKKPDNWDEDEDGLWKPPRYPSP 751
            +FFEERF+ GW   WV S+WK  E  AG +  T+GKW+GD +DKGIQT  D R YAISA+ PEFSNK+ TLV Q+S++ EQ ++CGGGY+KLLS  V+QKKFGGD PYS+MFGPDICG   K +H I +Y   N+ IKK++ CETD+LTH YTFILRPDA+YSILIDN+E+ +GS+YTDWD+LP +KIK   AKKP DWDD+E+I DP   KPEGYD IP EI DP AKKP++WD++EDG W  P  P+P
Sbjct:   27 VFFEERFEDGWEKRWVKSEWKKDESMAGEWNYTSGKWNGDANDKGIQTSEDYRFYAISAEFPEFSNKDNTLVFQFSVKHEQKLDCGGGYMKLLSGEVDQKKFGGDTPYSIMFGPDICGYSTKKVHAIFNYNDTNHLIKKDVPCETDQLTHVYTFILRPDATYSILIDNQEKQTGSLYTDWDLLPAKKIKDPEAKKPEDWDDKEFIPDPEDKKPEGYDDIPAEITDPEAKKPEDWDDEEDGEWTAPTIPNP 276          

HSP 2 Score: 78.5666 bits (192), Expect = 1.738e-113
Identity = 34/79 (43.04%), Postives = 50/79 (63.29%), Query Frame = 3
Query:  732 PQDTHPRYKGLWRPQRIKNPNYKGKWKIPYIDHPKF*KDPNPFLLSPLSM*AMKFWPGQAGSVYNTFLTRDDPAKAKTL 968
            P   +P YKG W+ ++IKNPNYKGKWK P ID+P+F  DP  ++   L    ++ W  ++G++++  L  DDP  AK L
Sbjct:  271 PTIPNPEYKGPWKAKKIKNPNYKGKWKAPMIDNPEFKDDPELYVYPKLRYVGVELWQVKSGTLFDNVLVCDDPEYAKQL 349          
BLAST of DY259733 vs. ExPASy Swiss-Prot
Match: CALR_ORYSJ (Calreticulin OS=Oryza sativa subsp. japonica GN=Os07g0246200 PE=1 SV=2)

HSP 1 Score: 350.132 bits (897), Expect = 1.119e-112
Identity = 153/250 (61.20%), Postives = 195/250 (78.00%), Query Frame = 2
Query:    2 IFFEERFDHGWRSPWVISDWKPSEGKAGYFKPTAGKWHGDPDDKGIQTPTDARHYAISAKIPEFSNKNRTLVVQYSIRFEQDIECGGGYIKLLSAYVNQKKFGGDAPYSLMFGPDICGTQKKHLHVILSYQGQNYPIKKELECETDKLTHFYTFILRPDASYSILIDNRERDSGSMYTDWDILPPRKIKAVNAKKPADWDDREYIDDPNAVKPEGYDSIPKEIPDPXAKKPDNWDEDEDGLWKPPRYPSP 751
            +FF+E+F+ GW S WV S+WK  E  AG +  T+GKW+GDP+DKGIQT  D R YAISA+ PEFSNK++TLV+Q+S++ EQ ++CGGGY+KLL   V+QKKFGGD PYS+MFGPDICG   K +H I +   +N+ IKK++ CETD+L+H YT I+ PDA+Y+ILIDN E+ SGS+Y  WDILPP++IK   AKKP DWDD+EYI DP   KPEGYD IPKEIPDP AKKP++WD++EDG W  P  P+P
Sbjct:   31 VFFQEKFEDGWESRWVKSEWKKDENMAGEWNHTSGKWNGDPEDKGIQTSEDYRFYAISAEYPEFSNKDKTLVLQFSVKHEQKLDCGGGYVKLLGGDVDQKKFGGDTPYSIMFGPDICGYSTKKVHTIFTKNDKNHLIKKDVPCETDQLSHVYTLIIHPDATYTILIDNVEKQSGSIYEHWDILPPKQIKDPEAKKPEDWDDKEYIPDPEDKKPEGYDDIPKEIPDPDAKKPEDWDDEEDGEWTAPTIPNP 280          

HSP 2 Score: 79.7221 bits (195), Expect = 1.119e-112
Identity = 34/78 (43.59%), Postives = 49/78 (62.82%), Query Frame = 3
Query:  732 PQDTHPRYKGLWRPQRIKNPNYKGKWKIPYIDHPKF*KDPNPFLLSPLSM*AMKFWPGQAGSVYNTFLTRDDPAKAKT 965
            P   +P YKG W+ ++IKNPNY+GKWK P ID+P F  DP  +    L    ++ W  ++G++++ FL  DDP  AKT
Sbjct:  275 PTIPNPEYKGPWKQKKIKNPNYQGKWKAPMIDNPDFKDDPYIYAFDSLKYIGIELWQVKSGTLFDNFLITDDPELAKT 352          
BLAST of DY259733 vs. ExPASy Swiss-Prot
Match: CALR_MAIZE (Calreticulin OS=Zea mays GN=CRT PE=2 SV=1)

HSP 1 Score: 335.88 bits (860), Expect = 4.679e-108
Identity = 149/250 (59.60%), Postives = 191/250 (76.40%), Query Frame = 2
Query:    2 IFFEERFDHGWRSPWVISDWKPSEGKAGYFKPTAGKWHGDPDDKGIQTPTDARHYAISAKIPEFSNKNRTLVVQYSIRFEQDIECGGGYIKLLSAYVNQKKFGGDAPYSLMFGPDICGTQKKHLHVILSYQGQNYPIKKELECETDKLTHFYTFILRPDASYSILIDNRERDSGSMYTDWDILPPRKIKAVNAKKPADWDDREYIDDPNAVKPEGYDSIPKEIPDPXAKKPDNWDEDEDGLWKPPRYPSP 751
            +FF+E+F+ GW S WV S+WK  E  AG +  T+GKW+GD +DKGIQT  D R YAISA+ PEFSNK++TLV+Q+S++ EQ ++CGGGY+KLL   V+QK  GGD  YS++  PDI     K +H IL+  G+N+ IKK++ C+TD+LTH YTFI+RPDA+YSILIDN E+ +GS+Y  WDILPP+KIK   AKKP DWDD+EYI DP   KPEGYD IPKEIPDP AKKP++WD++EDG W  P  P+P
Sbjct:   27 VFFQEKFEDGWESRWVKSEWKKDENMAGEWNHTSGKWNGDAEDKGIQTSEDYRFYAISAEYPEFSNKDKTLVLQFSVKHEQKLDCGGGYVKLLGGDVDQKTLGGDTSYSIISRPDISRYSTKKVHTILTKDGKNHLIKKDVPCQTDQLTHVYTFIIRPDATYSILIDNEEKHTGSIYEHWDILPPKKIKDPEAKKPEDWDDKEYIPDPEDKKPEGYDDIPKEIPDPDAKKPEDWDDEEDGEWTAPTIPNP 276          

HSP 2 Score: 78.5666 bits (192), Expect = 4.679e-108
Identity = 33/78 (42.31%), Postives = 49/78 (62.82%), Query Frame = 3
Query:  732 PQDTHPRYKGLWRPQRIKNPNYKGKWKIPYIDHPKF*KDPNPFLLSPLSM*AMKFWPGQAGSVYNTFLTRDDPAKAKT 965
            P   +P YKG W+ ++IKNPNY+GKWK P ID+P F  DP  +    L    ++ W  ++G++++  +  DDPA AKT
Sbjct:  271 PTIPNPEYKGPWKQKKIKNPNYQGKWKAPMIDNPDFKDDPYIYAFDSLKYIGIELWQVKSGTLFDNIIITDDPALAKT 348          
BLAST of DY259733 vs. ExPASy Swiss-Prot
Match: CALR_RICCO (Calreticulin OS=Ricinus communis PE=2 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 2.895e-99
Identity = 163/272 (59.93%), Postives = 208/272 (76.47%), Query Frame = 2
Query:    2 IFFEERFDHGWRSPWVISDWKPSEGKAGYFKPTAGKWHGDPDDKGIQTPTDARHYAISAKIPEFSNKNRTLVVQYSIRFEQDIECGGGYIKLLSAYVNQKKFGGDAPYSLMFGPDICGTQKKHLHVILSYQGQNYPIKKELECETDKLTHFYTFILRPDASYSILIDNRERDSGSMYTDWDILPPRKIKAVNAKKPADWDDREYIDDPNAVKPEGYDSIPKEIPDPXAKKPDNWDEDEDGLWKPPRYPSPL*RTMEAPEDQEPQL*REVEDP 817
            +FFEERF+ GW + WV SDWK  E  AG +  T+GKW+GDP+DKGIQT  D R YAISA+ PEFSNK++TLV Q+S++ EQ ++CGGGY+KLLS+  +QKKFGGD PYS+MFGPDICG   K +H IL+Y   N+ IKKE+ CETD+LTH YT ++RPDA+YSILIDN E+ +GS+YTDWD+LPP+KIK   AKKP DWD++EYI DP   KPEGYD IPKEIPDP AKKP++WD++EDG W  P        T+  PE + P   +++++P
Sbjct:   22 VFFEERFEDGWENRWVKSDWKKDENTAGEWNYTSGKWNGDPNDKGIQTSEDYRFYAISAEFPEFSNKDKTLVFQFSVKHEQKLDCGGGYMKLLSSSTDQKKFGGDTPYSIMFGPDICGYSTKKVHAILNYNDTNHLIKKEVPCETDQLTHVYTLVIRPDATYSILIDNVEKQTGSLYTDWDLLPPKKIKDPEAKKPEDWDEKEYIPDPEDKKPEGYDDIPKEIPDPDAKKPEDWDDEEDGEWTAP--------TIANPEYKGPWKPKKIKNP 285          

HSP 2 Score: 78.9518 bits (193), Expect = 4.896e-14
Identity = 34/79 (43.04%), Postives = 50/79 (63.29%), Query Frame = 3
Query:  732 PQDTHPRYKGLWRPQRIKNPNYKGKWKIPYIDHPKF*KDPNPFLLSPLSM*AMKFWPGQAGSVYNTFLTRDDPAKAKTL 968
            P   +P YKG W+P++IKNPNYKGKWK P ID+P F  DP  ++   L    ++ W  ++G++++  L  +DP  AK L
Sbjct:  266 PTIANPEYKGPWKPKKIKNPNYKGKWKAPMIDNPDFKDDPEIYVYPNLKYVGIELWQVKSGTLFDNVLICNDPEYAKQL 344          
The following BLAST results are available for this feature:
BLAST of DY259733 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 49
Match NameE-valueIdentityDescription
CALR3_ARATH5.381e-14179.52Calreticulin-3 OS=Arabidopsis thaliana GN=CRT3 PE=... [more]
CALR_BERST9.312e-11565.20Calreticulin OS=Berberis stolonifera PE=2 SV=1[more]
CALR_PRUAR1.215e-11463.60Calreticulin OS=Prunus armeniaca PE=2 SV=1[more]
CALR_NICPL2.069e-11463.20Calreticulin OS=Nicotiana plumbaginifolia GN=CAL1 ... [more]
CALR2_ARATH1.021e-11362.80Calreticulin-2 OS=Arabidopsis thaliana GN=CRT2 PE=... [more]
CALR1_ARATH1.332e-11362.80Calreticulin-1 OS=Arabidopsis thaliana GN=CRT1 PE=... [more]
CALR_BETVU1.738e-11362.80Calreticulin OS=Beta vulgaris PE=2 SV=1[more]
CALR_ORYSJ1.119e-11261.20Calreticulin OS=Oryza sativa subsp. japonica GN=Os... [more]
CALR_MAIZE4.679e-10859.60Calreticulin OS=Zea mays GN=CRT PE=2 SV=1[more]
CALR_RICCO2.895e-9959.93Calreticulin OS=Ricinus communis PE=2 SV=1[more]

Pages

back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YA11FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259733 ID=DY259733|Name=DY259733|organism=Citrus clementina|type=EST|length=992bp
GATCTTTTTTGAAGAGCGATTTGACCATGGATGGCGAAGTCCTTGGGTAA
TATCAGACTGGAAACCAAGTGAAGGGAAAGCTGGATATTTTAAGCCCACA
GCTGGAAAGTGGCATGGTGACCCGGATGATAAAGGTATTCAAACTCCCAC
CGATGCAAGACACTATGCCATATCTGCAAAAATACCAGAATTTAGCAACA
AAAACAGAACATTGGTTGTTCAGTATTCTATACGATTTGAGCAAGACATT
GAATGTGGTGGTGGATACATAAAACTTCTTTCTGCATATGTCAATCAAAA
GAAATTTGGCGGAGATGCTCCCTACAGTTTAATGTTTGGACCAGATATAT
GTGGCACGCAAAAGAAGCATCTCCATGTTATCCTCTCCTACCAGGGTCAG
AATTACCCCATCAAAAAGGAGCTGGAATGTGAAACAGACAAGTTGACTCA
TTTCTACACATTTATTCTCAGGCCTGATGCCAGTTATAGTATCCTCATTG
ATAACCGAGAGAGGGATTCTGGTAGCATGTACACGGATTGGGATATTCTT
CCTCCACGGAAAATCAAAGCTGTCAATGCCAAAAAGCCAGCGGATTGGGA
TGATAGAGAATATATTGATGATCCTAATGCCGTCAAACCAGAGGGATATG
ATTCAATTCCAAAAGAAATTCCAGACCCGNAAGCTAAGAAGCCCGACAAT
TGGGATGAAGACGAGGATGGCCTATGGAAACCCCCAAGATACCCATCCCC
GCTATAAAGGACTATGGAGGCCCCAGAGGATCAAGAACCCCAACTATAAA
GGGAAGTGGAAGATCCCCTACATTGACCATCCCAAATTTTGAAAAGATCC
CAATCCTTTCCTGCTTAGCCCATTAAGTATGTAGGCCATGAAGTTTTGGC
CGGGCCAGGCCGGGTCCGTTTATAACACCTTTTTAACCCGTGATGATCCC
GCCAAGGCCAAAACATTGGGTCCAGGAATTTCCCTCCTAACC
back to top