DY259734

Overview
NameDY259734
Unique NameDY259734
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1086
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14276 contig Ccv1_Contig14276:45..1131. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY259734 vs. ExPASy Swiss-Prot
Match: PSB6_TOBAC (Proteasome subunit beta type-6 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 4.814e-96
Identity = 165/188 (87.77%), Postives = 175/188 (93.09%), Query Frame = 2
Query:   83 DFNAPHSMGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVSLAIARDGASGGVVRTVTI 646
            D + PHSMGTTIIGVTYNGGVVLGADSRTSTG+YVANRASDKITQLTDNVY+CRSGSAADSQ VSDYVRYFLHQHTIQLGQPATVKVAANL RLLSYNNK+ LQTGMI+GGWDKYEGGKIYG+P GGT++EQPFAI      YLYGFFDQAWKEGMT+EEAE+LVV AVSLAIARDGASGGVVRTVTI
Sbjct:    5 DVDQPHSMGTTIIGVTYNGGVVLGADSRTSTGMYVANRASDKITQLTDNVYVCRSGSAADSQIVSDYVRYFLHQHTIQLGQPATVKVAANLTRLLSYNNKDRLQTGMIIGGWDKYEGGKIYGIPPGGTVLEQPFAIGGSGSSYLYGFFDQAWKEGMTQEEAEKLVVTAVSLAIARDGASGGVVRTVTI 192          

HSP 2 Score: 39.2762 bits (90), Expect = 4.814e-96
Identity = 16/25 (64.00%), Postives = 19/25 (76.00%), Query Frame = 1
Query:  652 EGVSRKFHPGHPLPLWHEELEPQNS 726
            +G +RKF+ G  L LWHEELEP NS
Sbjct:  195 DGATRKFYSGDSLQLWHEELEPVNS 219          
BLAST of DY259734 vs. ExPASy Swiss-Prot
Match: PSB6_ARATH (Proteasome subunit beta type-6 OS=Arabidopsis thaliana GN=PBA1 PE=1 SV=2)

HSP 1 Score: 345.51 bits (885), Expect = 3.186e-94
Identity = 174/231 (75.32%), Postives = 192/231 (83.12%), Query Frame = 2
Query:   65 MDLKMEDFNAPHSMGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVSLAIARDGASGGVVRTVTIILKE*AESSTPATPFPCGMRSWSPKIPLLDLMNVARP 757
            MDL ++   APHSMGTTIIGVTYNGGVVLGADSRTSTG+YVANRASDKITQLTDNVY+CRSGSAADSQ VSDYVRYFLHQHTIQ GQPATVKV+ANL+R+L+YNNKN LQTG+IVGGWDKYEGGKIYG+PLGGT++EQPFAI      YLYGFFDQAWK+ MTKEEAEQLVVKAVSLAIARDGASGGVVRTV I  +    +  P            P+  LLD++N A P
Sbjct:    1 MDLNLD---APHSMGTTIIGVTYNGGVVLGADSRTSTGMYVANRASDKITQLTDNVYVCRSGSAADSQVVSDYVRYFLHQHTIQHGQPATVKVSANLIRMLAYNNKNMLQTGLIVGGWDKYEGGKIYGIPLGGTVVEQPFAIGGSGSSYLYGFFDQAWKDNMTKEEAEQLVVKAVSLAIARDGASGGVVRTVIINSEGVTRNFYPGDKLQLWHEELEPQNSLLDILNAAGP 228          
BLAST of DY259734 vs. ExPASy Swiss-Prot
Match: PSB6_DICDI (Proteasome subunit beta type-6 OS=Dictyostelium discoideum GN=psmB6 PE=1 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 1.769e-52
Identity = 94/181 (51.93%), Postives = 134/181 (74.03%), Query Frame = 2
Query:  104 MGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVSLAIARDGASGGVVRTVTI 646
            +GT+I+ V Y+GGV++GADSRT+TG Y+ANR ++KIT + + +Y CRSGSAAD+Q +SDYVRY+L  HT +L     VK AA+L +LL Y+NKN L  G+IV GWDK++GG +Y + LGG++++QPFAI      Y+YG+ D  +K  MTK+E  + V  +++LA+ RDG+SGGV+R   I
Sbjct:   13 LGTSIMAVEYDGGVIMGADSRTTTGAYIANRVTNKITPIHERIYCCRSGSAADTQAISDYVRYYLEMHTSELCDEPDVKTAASLFQLLCYSNKNNLMAGIIVAGWDKHQGGSVYNISLGGSMVKQPFAIGGSGSTYIYGYCDSKFKPKMTKDECIEFVQNSLALAMFRDGSSGGVIRLCII 193          
BLAST of DY259734 vs. ExPASy Swiss-Prot
Match: PSB6_BOVIN (Proteasome subunit beta type-6 OS=Bos taurus GN=PSMB6 PE=1 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 2.162e-50
Identity = 94/186 (50.54%), Postives = 129/186 (69.35%), Query Frame = 2
Query:   89 NAPHSMGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVSLAIARDGASGGVVRTVTI 646
            N   S GTTI+ V ++GGVVLGADSRT+TG Y+ANR +DK+T + D ++ CRSGSAAD+Q V+D V Y L  H+I+L +P  V  AA+L + + Y  +  L  G+I+ GWD  EGG++Y VP+GG ++ QPFAI      Y+YG+ D  ++EGMTKEE  Q    A++LA+ RDG+SGGV+R   I
Sbjct:   28 NREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQPFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAI 213          
BLAST of DY259734 vs. ExPASy Swiss-Prot
Match: PSB6_MOUSE (Proteasome subunit beta type-6 OS=Mus musculus GN=Psmb6 PE=1 SV=3)

HSP 1 Score: 197.978 bits (502), Expect = 8.215e-50
Identity = 93/186 (50.00%), Postives = 129/186 (69.35%), Query Frame = 2
Query:   89 NAPHSMGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVSLAIARDGASGGVVRTVTI 646
            N   S GTTI+ V +NGGVVLGADSRT+TG Y+ANR +DK+T + D+++ CRSGSAAD+Q V+D V Y L  H+I+L +P  V  AA+L + + Y  +  L  G+I+ GWD  EGG++Y VP+GG ++ Q FAI      Y+YG+ D  ++EGMTK+E  Q    A++LA+ RDG+SGGV+R   I
Sbjct:   27 NREVSTGTTIMAVQFNGGVVLGADSRTTTGSYIANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKDECLQFTANALALAMERDGSSGGVIRLAAI 212          
BLAST of DY259734 vs. ExPASy Swiss-Prot
Match: PSB6_HUMAN (Proteasome subunit beta type-6 OS=Homo sapiens GN=PSMB6 PE=1 SV=4)

HSP 1 Score: 196.438 bits (498), Expect = 2.390e-49
Identity = 92/182 (50.55%), Postives = 127/182 (69.78%), Query Frame = 2
Query:  101 SMGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVSLAIARDGASGGVVRTVTI 646
            S GTTI+ V ++GGVVLGADSRT+TG Y+ANR +DK+T + D ++ CRSGSAAD+Q V+D V Y L  H+I+L +P  V  AA+L + + Y  +  L  G+I+ GWD  EGG++Y VP+GG ++ Q FAI      Y+YG+ D  ++EGMTKEE  Q    A++LA+ RDG+SGGV+R   I
Sbjct:   32 STGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAI 213          
BLAST of DY259734 vs. ExPASy Swiss-Prot
Match: PSB6_RAT (Proteasome subunit beta type-6 OS=Rattus norvegicus GN=Psmb6 PE=1 SV=3)

HSP 1 Score: 196.052 bits (497), Expect = 3.122e-49
Identity = 92/186 (49.46%), Postives = 129/186 (69.35%), Query Frame = 2
Query:   89 NAPHSMGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVSLAIARDGASGGVVRTVTI 646
            N   S GTTI+ V ++GGVVLGADSRT+TG Y+ANR +DK+T + D+++ CRSGSAAD+Q V+D V Y L  H+I+L +P  V  AA+L + + Y  +  L  G+I+ GWD  EGG++Y VP+GG ++ Q FAI      Y+YG+ D  ++EGMTK+E  Q    A++LA+ RDG+SGGV+R   I
Sbjct:   27 NREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKDECLQFTANALALAMERDGSSGGVIRLAAI 212          
BLAST of DY259734 vs. ExPASy Swiss-Prot
Match: PSB6_SCHPO (Probable proteasome subunit beta type-6 OS=Schizosaccharomyces pombe GN=SPBC4C3.10c PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 5.325e-49
Identity = 91/181 (50.28%), Postives = 127/181 (70.17%), Query Frame = 2
Query:  104 MGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVSLAIARDGASGGVVRTVTI 646
            MGTTI  + Y  GV+L ADSRT+ G Y+ANR +DK+TQLTDN++ CRSGSAAD+QTV+D ++Y+L  + IQ G   +V  AA L   + Y NKN L  G+IV G+D+  GG +Y +PLGG++ +QP AI      ++YGF D  ++E MT+EEA + +  AV+LA+ RDG+SGG +R V +
Sbjct:   23 MGTTITALRYKDGVILAADSRTTMGAYIANRVTDKLTQLTDNIWCCRSGSAADTQTVADLLKYYLSMYRIQFGHDPSVHTAATLASEMCYQNKNMLSAGLIVAGYDEKTGGDVYSIPLGGSLHKQPLAIGGSGSAFIYGFCDANFRENMTQEEAVEFLKNAVALAMERDGSSGGTIRMVIL 203          
BLAST of DY259734 vs. ExPASy Swiss-Prot
Match: PSB6_YEAST (Proteasome component PRE3 OS=Saccharomyces cerevisiae GN=PRE3 PE=1 SV=2)

HSP 1 Score: 176.022 bits (445), Expect = 3.343e-43
Identity = 83/182 (45.60%), Postives = 129/182 (70.88%), Query Frame = 2
Query:  101 SMGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVSLAIARDGASGGVVRTVTI 646
            S+GT+I+ VT+  GV+LGADSRT+TG Y+ANR +DK+T++ D ++ CRSGSAAD+Q ++D V+Y L  +T Q G P+T + AA++ + L Y NK+ L  G+IV G+D    G++Y +PLGG++ + P+AI      ++YG+ D+ ++E M+KEE    +  ++S AI  DG+SGGV+R V +
Sbjct:   17 SLGTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPST-ETAASVFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSGGVIRMVVL 197          
BLAST of DY259734 vs. ExPASy Swiss-Prot
Match: PSB9_RAT (Proteasome subunit beta type-9 OS=Rattus norvegicus GN=Psmb9 PE=1 SV=2)

HSP 1 Score: 172.555 bits (436), Expect = 3.696e-42
Identity = 84/180 (46.67%), Postives = 119/180 (66.11%), Query Frame = 2
Query:  107 GTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVSLAIARDGASGGVVRTVTI 646
            GTTI+ V ++GGVV+G+DSR S G  V NR  DK++ L   +Y   SGSAAD+Q ++D   Y L  H ++L +P  V  AAN+V+ +SY  +  L   ++V GWD++EGG++YG  +GG +I QPFAI      Y+YG+ D A+K GMT EE  +    A++LA+ RDG+SGGV+  VTI
Sbjct:   20 GTTIMAVEFDGGVVVGSDSRVSAGAAVVNRVFDKLSPLHQRIYCALSGSAADAQAIADMAAYQLELHGLELEEPPLVLAAANIVKNISYKYREDLLAHLMVAGWDQHEGGQVYGT-MGGMLIRQPFAIGGSGSTYIYGYVDAAYKPGMTPEECRRFTTDAITLAMNRDGSSGGVIYLVTI 198          
The following BLAST results are available for this feature:
BLAST of DY259734 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 65
Match NameE-valueIdentityDescription
PSB6_TOBAC4.814e-9687.77Proteasome subunit beta type-6 OS=Nicotiana tabacu... [more]
PSB6_ARATH3.186e-9475.32Proteasome subunit beta type-6 OS=Arabidopsis thal... [more]
PSB6_DICDI1.769e-5251.93Proteasome subunit beta type-6 OS=Dictyostelium di... [more]
PSB6_BOVIN2.162e-5050.54Proteasome subunit beta type-6 OS=Bos taurus GN=PS... [more]
PSB6_MOUSE8.215e-5050.00Proteasome subunit beta type-6 OS=Mus musculus GN=... [more]
PSB6_HUMAN2.390e-4950.55Proteasome subunit beta type-6 OS=Homo sapiens GN=... [more]
PSB6_RAT3.122e-4949.46Proteasome subunit beta type-6 OS=Rattus norvegicu... [more]
PSB6_SCHPO5.325e-4950.28Probable proteasome subunit beta type-6 OS=Schizos... [more]
PSB6_YEAST3.343e-4345.60Proteasome component PRE3 OS=Saccharomyces cerevis... [more]
PSB9_RAT3.696e-4246.67Proteasome subunit beta type-9 OS=Rattus norvegicu... [more]

Pages

back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YA12FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259734 ID=DY259734|Name=DY259734|organism=Citrus clementina|type=EST|length=1086bp
AACTTAAAATTAATTTTGTTAAGGGCATTTAGAAATTGTGGTAAGTGAGT
GTTTTAGAGGAAAGATGGATCTGAAGATGGAAGATTTTAACGCGCCACAC
TCGATGGGTACTACTATCATCGGCGTCACTTACAACGGCGGCGTTGTCCT
CGGCGCCGATTCTCGTACTAGCACCGGGGTGTATGTTGCTAACCGAGCTT
CAGACAAGATTACGCAGCTCACTGATAATGTCTACCTTTGCCGCTCGGGA
TCGGCTGCAGATTCTCAGACTGTCTCCGACTATGTTCGCTACTTCCTTCA
TCAACACACGATACAGCTAGGGCAGCCTGCAACTGTTAAAGTTGCTGCCA
ATCTTGTCAGGCTGCTATCCTACAATAACAAGAACTTTTTGCAAACTGGA
ATGATTGTTGGCGGTTGGGATAAGTATGAAGGTGGTAAAATTTATGGAGT
TCCTCTTGGAGGAACAATAATTGAGCAGCCTTTTGCAATTGGAGGATCTG
GCTCAAGTTACCTGTATGGGTTTTTTGATCAGGCATGGAAAGAGGGAATG
ACCAAGGAAGAAGCTGAGCAATTAGTGGTTAAAGCAGTTTCTCTTGCCAT
TGCGCGTGATGGTGCTAGTGGAGGTGTTGTTCGAACCGTCACAATTATTC
TGAAGGAGTGAGCAGAAAGTTCCACCCCGGCCACCCCCTTCCCTTGTGGC
ATGAGGAGTTGGAGCCCCAAAATTCCTTTGCTGGACCTGATGAATGTAGC
CCGTCCCTGAGCCGATGAACCATGTGAAGAAAGAGGATTTCCCCCTTGTC
CTACTACCTTTTCCCCCCAGGGGGGTATTCCCTCTTTATCCTGGAAAAAG
CCCCGGAGGTTCCCCCCCGCCGGGAATTTCCCCCGGTTTTTTTTTTTTTT
TCAAAAAAAAAAAAATTTTACTCCCCCGGGAAAACCCTCCCAATCATAAC
GGGGGGTTTGGAGGGATGAATTTTTTATTTGGTGGAAGCCCTTTTCTCCC
CCAAAACAAACAACAAAAAAACAAACCCACCTCCTTCTCTGTCTCCAACT
TCGCGCACTAACACGAAAAACCCTCTCCCTTCACTC
back to top