DY259737

Overview
NameDY259737
Unique NameDY259737
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length604
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DY259737_ssr492 microsatellite DY259737_ssr492:492..503. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig1293 contig Ccv1_Contig1293:1..604. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY259737 vs. ExPASy Swiss-Prot
Match: ATP5E_ARATH (ATP synthase subunit epsilon, mitochondrial OS=Arabidopsis thaliana GN=At1g51650 PE=1 SV=3)

HSP 1 Score: 137.502 bits (345), Expect = 5.026e-32
Identity = 62/69 (89.86%), Postives = 66/69 (95.65%), Query Frame = 1
Query:   70 MASNAAVPFWRAAGMTYISYSNICANLVRNCLKEPYKTEALTREKVHFSISKWTDGKPQKPTIRSDTPE 276
            MASNAAVPFWRAAGMTYISYSNICAN+VRNCLKEP+K EALTREKVHFS+SKW DGKPQKP +RSDTPE
Sbjct:    1 MASNAAVPFWRAAGMTYISYSNICANIVRNCLKEPHKAEALTREKVHFSLSKWADGKPQKPVLRSDTPE 69          
BLAST of DY259737 vs. ExPASy Swiss-Prot
Match: ATP5E_IPOBA (ATP synthase subunit epsilon, mitochondrial OS=Ipomoea batatas PE=1 SV=2)

HSP 1 Score: 133.265 bits (334), Expect = 9.479e-31
Identity = 60/70 (85.71%), Postives = 65/70 (92.86%), Query Frame = 1
Query:   70 MASNAAVPFWRAAGMTYISYSNICANLVRNCLKEPYKTEALTREKVHFSISKWTDGKPQKPTIRSDTPEE 279
            MASNAAVPFWRAAGMTYI+YSN+CAN+VRNCLKEPY+ EAL+REKVHFS SKW DGKPQKP IRSDT EE
Sbjct:    1 MASNAAVPFWRAAGMTYITYSNLCANMVRNCLKEPYRAEALSREKVHFSFSKWVDGKPQKPAIRSDTGEE 70          
BLAST of DY259737 vs. ExPASy Swiss-Prot
Match: ATP5E_MAIZE (ATP synthase subunit epsilon, mitochondrial OS=Zea mays PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 4.121e-26
Identity = 52/68 (76.47%), Postives = 62/68 (91.18%), Query Frame = 1
Query:   73 ASNAAVPFWRAAGMTYISYSNICANLVRNCLKEPYKTEALTREKVHFSISKWTDGKPQKPTIRSDTPE 276
            A+ AAVPFWRAAGMTYI YSNICA LVRNCLKEP+K+EA +REKVHFSISKWTDGK +KPT+R+++ +
Sbjct:    3 ATTAAVPFWRAAGMTYIGYSNICAALVRNCLKEPFKSEAASREKVHFSISKWTDGKQEKPTVRTESDD 70          
The following BLAST results are available for this feature:
BLAST of DY259737 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
ATP5E_ARATH5.026e-3289.86ATP synthase subunit epsilon, mitochondrial OS=Ara... [more]
ATP5E_IPOBA9.479e-3185.71ATP synthase subunit epsilon, mitochondrial OS=Ipo... [more]
ATP5E_MAIZE4.121e-2676.47ATP synthase subunit epsilon, mitochondrial OS=Zea... [more]
back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YA17FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259737 ID=DY259737|Name=DY259737|organism=Citrus clementina|type=EST|length=604bp
GTTTTCTTTCGCTAGCTGACGGCAACCCACAAAGAGAGAGCAAGAGAGAA
AGAAGAAAGAAAAAAGCAAATGGCTTCAAACGCAGCGGTGCCGTTTTGGA
GAGCAGCGGGGATGACATACATATCGTACTCGAACATCTGTGCGAATCTG
GTGAGGAATTGTCTCAAGGAACCTTACAAAACCGAGGCCCTCACTCGCGA
GAAGGTTCACTTCTCTATCTCTAAGTGGACCGATGGCAAACCCCAGAAAC
CCACTATTCGTTCTGATACTCCGGAAGAATGAGTCCAATGGTAAATTCGT
GTCCAAATGTCAGTGTGGAGTGGAACAATGTGTGCGGCAAAGCTTTTTTC
TGTTTCATTATTTGGTAGATTTAATCTTATTGGGTCAGTAATGCATAAAA
CTCTCGAACAACATTTGCATTTCTGTTTCTGCATGGCAAATGCATTTGTA
ATAATTTAACTGGCATTGACCTACTTTGGAAACTAGACTTATGTTTGTTT
GTTCTTCATAGAAATTGATGGATATATATTTTCCAAGTGATGTTGGTGTG
ATTTTCAGTAGTAAGAATGGTGGGATTTGCATGTCCTCTATTTCCCCTTT
TTCG
back to top