DY259738

Overview
NameDY259738
Unique NameDY259738
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1040
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY259738 vs. ExPASy Swiss-Prot
Match: PCKA_CUCSA (Phosphoenolpyruvate carboxykinase [ATP] OS=Cucumis sativus GN=PCK PE=2 SV=1)

HSP 1 Score: 451.44 bits (1160), Expect = 3.868e-126
Identity = 225/279 (80.65%), Postives = 243/279 (87.10%), Query Frame = 3
Query:   69 SDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGTVLENIVFDEHTREVDYLDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNIILLACDAFGVLPPVSKLSLEQTMYHFISGYTALVAGTEEGVKEPRATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGSGNRIKLAFTRRIIDAIHSGTLLEASYTKTPVFGLETPTEIKGVPSEILDPEKTWAGNEGLQGYTP*SLGNPFQKKF*GALGIHRIGKEHQA-LPERFLASGP 902
            SDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGTVLEN+VFDEHTREVDY +KSVTENTRAAYPIEYIPNAKIPCVGPHPKN+ILLACDAFGVLPPVSKLSL QTMYHFISGYTALVAGTEEGVKEP+ATFSACFGAAFIMLHP++YAAMLAEKM+KHGATGWLVNTGWSGGSYGSGNRIKLA+TR+IIDAIHSG LLEA+Y+KT VFGLE P  I+GVPS ILDP  TW+  +G    T   LG  F+K +    GIH    E  + L E  LA+GP
Sbjct:  394 SDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGTVLENVVFDEHTREVDYSEKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLSLPQTMYHFISGYTALVAGTEEGVKEPQATFSACFGAAFIMLHPSRYAAMLAEKMKKHGATGWLVNTGWSGGSYGSGNRIKLAYTRKIIDAIHSGALLEANYSKTRVFGLEIPDAIEGVPSHILDPINTWSDKDGYH-ETLLKLGGLFKKNY---EGIHTYQVERDSELAEEILAAGP 668          
BLAST of DY259738 vs. ExPASy Swiss-Prot
Match: PCKA_ARATH (Phosphoenolpyruvate carboxykinase [ATP] OS=Arabidopsis thaliana GN=PCKA PE=1 SV=1)

HSP 1 Score: 439.113 bits (1128), Expect = 1.987e-122
Identity = 214/280 (76.43%), Postives = 242/280 (86.43%), Query Frame = 3
Query:   69 SDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGTVLENIVFDEHTREVDYLDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNIILLACDAFGVLPPVSKLSLEQTMYHFISGYTALVAGTEEGVKEPRATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGSGNRIKLAFTRRIIDAIHSGTLLEASYTKTPVFGLETPTEIKGVPSEILDPEKTWAGNEGLQGYTP*SLGNPFQKKF*GALGIHRIGKEHQALPERFLASGPLF 908
            ++ GVSNIEGGCYAKC+DLSREKEPDIWNAIKFGTVLEN+VFDEHTREVDY DKSVTENTRAAYPIE+IPNAKIPCVGPHP N+ILLACDAFGVLPPVSKL+L QTMYHFISGYTALVAGTE+G+KEP ATFSACFGAAFIMLHPTKYAAMLAEKM+  GATGWLVNTGWSGGSYG GNRIKLA+TR+IIDAIHSG+LL+A+Y KT +FG E PTEI+G+PSEILDP  +W+  +  +  T   LG  F+K F      H+IG + + L E  LA+GP+F
Sbjct:  395 TETGVSNIEGGCYAKCVDLSREKEPDIWNAIKFGTVLENVVFDEHTREVDYSDKSVTENTRAAYPIEFIPNAKIPCVGPHPTNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMKSQGATGWLVNTGWSGGSYGVGNRIKLAYTRKIIDAIHSGSLLKANYKKTEIFGFEIPTEIEGIPSEILDPVNSWSDKKAHKD-TLVKLGGLFKKNF-EVFANHKIGVDGK-LTEEILAAGPIF 671          
BLAST of DY259738 vs. ExPASy Swiss-Prot
Match: PCKA_MAIZE (Phosphoenolpyruvate carboxykinase [ATP] OS=Zea mays PE=2 SV=1)

HSP 1 Score: 428.713 bits (1101), Expect = 2.685e-119
Identity = 214/280 (76.43%), Postives = 234/280 (83.57%), Query Frame = 3
Query:   69 SDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGTVLENIVFDEHTREVDYLDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNIILLACDAFGVLPPVSKLSLEQTMYHFISGYTALVAGTEEGVKEPRATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGSGNRIKLAFTRRIIDAIHSGTLLEASYTKTPVFGLETPTEIKGVPSEILDPEKTWAGNEGLQGYTP*SLGNPFQKKF*GALGIHRIGKEHQALPERFLASGPLF 908
            SDNGVSNIEGGCYAKCIDL++EKEPDIWNAIKFGTVLEN+VFDEHTREVDY D SVTENTRAAYPIEYIP AKIPCVGPHPKN+ILLACDAFGVLPPVSKL L QTMYHFISGYTALVAGTE+G+KEP+ATFSACFGAAFIMLHPTKYAAMLAEKMQK+GATGWLVNTGWSGG YG G RI+L +TR+IIDAIHSG LL A+Y KT VFGLE PTEI GVPSEILDP  TW      +      LG  F+  F      ++IG +  +L +  LA+GP F
Sbjct:  390 SDNGVSNIEGGCYAKCIDLAQEKEPDIWNAIKFGTVLENVVFDEHTREVDYADYSVTENTRAAYPIEYIPIAKIPCVGPHPKNVILLACDAFGVLPPVSKLILAQTMYHFISGYTALVAGTEDGIKEPQATFSACFGAAFIMLHPTKYAAMLAEKMQKYGATGWLVNTGWSGGRYGVGKRIRLPYTRKIIDAIHSGELLTANYQKTEVFGLEIPTEINGVPSEILDPIYTWTDKAAYKENLL-RLGGLFKNNF-EVFASYKIG-DDSSLTDEILAAGPNF 666          
BLAST of DY259738 vs. ExPASy Swiss-Prot
Match: PCKA1_UROPA (Phosphoenolpyruvate carboxykinase [ATP] 1 OS=Urochloa panicoides GN=PCK1 PE=1 SV=1)

HSP 1 Score: 428.328 bits (1100), Expect = 3.507e-119
Identity = 212/280 (75.71%), Postives = 236/280 (84.29%), Query Frame = 3
Query:   69 SDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGTVLENIVFDEHTREVDYLDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNIILLACDAFGVLPPVSKLSLEQTMYHFISGYTALVAGTEEGVKEPRATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGSGNRIKLAFTRRIIDAIHSGTLLEASYTKTPVFGLETPTEIKGVPSEILDPEKTWAGNEGLQGYTP*SLGNPFQKKF*GALGIHRIGKEHQALPERFLASGPLF 908
            SDNGVSNIEGGCYAKCIDLS+EKEPDIWNAI FGTVLEN+VF+E TREVDY DKS+TENTRAAYPIE+IPNAKIPCVGPHPKN+ILLACDA+GVLPPVSKL+L QTMYHFISGYTA+VAGTE+GVKEP ATFSACFGAAFIM HPTKYAAMLAEKMQK+G TGWLVNTGWSGG YG GNRIKL +TR+IIDAIHSG LL A+Y KT VFGLE PTEI GVPSEILDP  TW  ++     T   L   F+  F      ++IG ++ +L E+ LA+GP F
Sbjct:  348 SDNGVSNIEGGCYAKCIDLSKEKEPDIWNAITFGTVLENVVFNERTREVDYADKSITENTRAAYPIEFIPNAKIPCVGPHPKNVILLACDAYGVLPPVSKLNLAQTMYHFISGYTAIVAGTEDGVKEPTATFSACFGAAFIMYHPTKYAAMLAEKMQKYGRTGWLVNTGWSGGRYGVGNRIKLPYTRKIIDAIHSGELLTANYKKTEVFGLEIPTEINGVPSEILDPVNTWT-DKAAYKETLLKLAGLFKNNF-EVFASYKIGDDN-SLTEQILAAGPNF 624          
BLAST of DY259738 vs. ExPASy Swiss-Prot
Match: PCKA2_UROPA (Phosphoenolpyruvate carboxykinase [ATP] 2 OS=Urochloa panicoides GN=PCK2 PE=2 SV=1)

HSP 1 Score: 426.017 bits (1094), Expect = 1.740e-118
Identity = 212/280 (75.71%), Postives = 234/280 (83.57%), Query Frame = 3
Query:   69 SDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGTVLENIVFDEHTREVDYLDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNIILLACDAFGVLPPVSKLSLEQTMYHFISGYTALVAGTEEGVKEPRATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGSGNRIKLAFTRRIIDAIHSGTLLEASYTKTPVFGLETPTEIKGVPSEILDPEKTWAGNEGLQGYTP*SLGNPFQKKF*GALGIHRIGKEHQALPERFLASGPLF 908
            SDNGVSNIEGGCYAKCIDLS+EKEPDIWNAIKFGTVLEN+VF+E TREVDY DKS+TENTRAAYPIE+IPNAKIPCVGPHPKN+ILLACDA+GVLPPVSKL+L QTMYHFISGYTA+VAGTE+GVKEP ATFSACFGAAFIM HPTKYAAMLAEKMQK+GATGWLVNTGWSGG YG GNRIKL +TR+IIDAIHSG LL ASY KT VFGLE PT I GVPSEIL P  TW  ++     T   L   F+  F      ++IG  + +L E+ LA+ P F
Sbjct:  350 SDNGVSNIEGGCYAKCIDLSQEKEPDIWNAIKFGTVLENVVFNERTREVDYADKSITENTRAAYPIEFIPNAKIPCVGPHPKNVILLACDAYGVLPPVSKLNLAQTMYHFISGYTAIVAGTEDGVKEPTATFSACFGAAFIMYHPTKYAAMLAEKMQKYGATGWLVNTGWSGGRYGVGNRIKLPYTRKIIDAIHSGELLNASYKKTEVFGLEIPTAINGVPSEILGPVNTWT-DKAAYKETLLKLAGLFKNNF-EVFASYKIG-NNNSLTEQILAAAPNF 626          
BLAST of DY259738 vs. ExPASy Swiss-Prot
Match: PCKA_DICDI (Phosphoenolpyruvate carboxykinase [ATP] OS=Dictyostelium discoideum GN=pckA PE=1 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 4.467e-90
Identity = 155/235 (65.96%), Postives = 184/235 (78.30%), Query Frame = 3
Query:   69 SDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGTVLENIVFDEHTREVDYLDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNIILLACDAFGVLPPVSKLSLEQTMYHFISGYTALVAGTEEGVKEPRATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGSGNRIKLAFTRRIIDAIHSGTLLEASYTKTPVFGLETPTEIKGVPSEILDPEKTWAGNE 773
            +D G  NIEGGCYAKCIDLSREKEP+I++AIKFG VLEN+V++E++R+VDY D S+TENTR AYP+E+IPNAK P +  HPKNII+L CDAFG+LPPVS+L   Q MYHFI GYTA VAGTE GV EP ATFS+C+G  FI+ HPTKYA MLA ++ KH A  WL+NTGW+GGS+G G+RIKLA+TR IIDAIHSG L +   TK  VFG + P    GVPSEIL P   WA  E
Sbjct:  291 TDTGCFNIEGGCYAKCIDLSREKEPEIFDAIKFGAVLENVVYNEYSRKVDYNDVSITENTRCAYPLEHIPNAKFPAIAGHPKNIIMLTCDAFGILPPVSRLDANQVMYHFIQGYTAKVAGTEVGVTEPTATFSSCYGEPFIVWHPTKYAEMLASQLHKHSARAWLINTGWTGGSHGVGSRIKLAYTRAIIDAIHSGELEKIPTTKMDVFGFQVPNSCPGVPSEILMPINGWADKE 525          
BLAST of DY259738 vs. ExPASy Swiss-Prot
Match: PCKA_ASHGO (Phosphoenolpyruvate carboxykinase [ATP] OS=Ashbya gossypii GN=PCK1 PE=3 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 2.895e-89
Identity = 157/255 (61.57%), Postives = 191/255 (74.90%), Query Frame = 3
Query:   69 SDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGTVLENIVFDEHTREVDYLDKSVTENTRAAYPIEYIPNAKIPCVGP-HPKNIILLACDAFGVLPPVSKLSLEQTMYHFISGYTALVAGTEEGVKEPRATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSY-GSGNRIKLAFTRRIIDAIHSGTLLEASYTKTPVFGLETPTEIKGVPSEILDPEKTWAGNEGLQGYTP*SLGNPFQKKF 827
            SD GV NIEGGCYAKCI LS EKEP+I+NAIK+G+VLEN+V+D  TR VDY D S+TENTR AYPIEYIP+A+IPC+   HP NI+LL CDA GVLPPVS+L+ EQ MYHFISGYT+ +AGTE+GV EP ATFS+CFG  F+ LHP KYA MLAEKM +H A+ WL+NTGW+G SY   G R  L +TR I+D+IH GTL +A Y   PVFGL  P  ++GVP+E+L+P K W   EG       +L + F + F
Sbjct:  269 SDYGVFNIEGGCYAKCIGLSGEKEPEIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENF 523          
BLAST of DY259738 vs. ExPASy Swiss-Prot
Match: PCKA_CANGA (Phosphoenolpyruvate carboxykinase [ATP] OS=Candida glabrata GN=PCK1 PE=3 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 2.451e-88
Identity = 150/237 (63.29%), Postives = 188/237 (79.32%), Query Frame = 3
Query:   69 SDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGTVLENIVFDEHTREVDYLDKSVTENTRAAYPIEYIPNAKIPCVGP-HPKNIILLACDAFGVLPPVSKLSLEQTMYHFISGYTALVAGTEEGVKEPRATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGS-GNRIKLAFTRRIIDAIHSGTLLEASYTKTPVFGLETPTEIKGVPSEILDPEKTWAGNE 773
            SD GV NIEGGCYAKCI+LSREKEP+I++AI+FG+VLEN+++D  + EVDY D S+TENTR AYPI++IP+AKIPC+ P HPKNIILL CDA GVLPPVSKL+ EQ MYHFISGYT+ +AGTE+GV EP  TFS+CFG  F+ LHP +YA MLAEKM +H A  WL+NTGW+G SY S G R  L +TR I+DAIH G+L +A +   P+F L+ P  ++GVPSE+L+P + W+  E
Sbjct:  272 SDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKAVEGVPSELLNPARNWSEGE 508          
BLAST of DY259738 vs. ExPASy Swiss-Prot
Match: PCKA_KLULA (Phosphoenolpyruvate carboxykinase [ATP] OS=Kluyveromyces lactis GN=PCK1 PE=3 SV=2)

HSP 1 Score: 322.783 bits (826), Expect = 2.075e-87
Identity = 163/282 (57.80%), Postives = 200/282 (70.92%), Query Frame = 3
Query:   69 SDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGTVLENIVFDEHTREVDYLDKSVTENTRAAYPIEYIPNAKIPCVGPH-PKNIILLACDAFGVLPPVSKLSLEQTMYHFISGYTALVAGTEEGVKEPRATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSY-GSGNRIKLAFTRRIIDAIHSGTLLEASYTKTPVFGLETPTEI-KGVPSEILDPEKTWAGNEGLQGYTP*SLGNPFQKKF*GALGIHRIGKEHQ-ALPERFLASGP 902
            SD+GV NIEGGCYAKC+ LS EKEP+I+NAIKFG+VLENI++D +TREVDY D ++TENTR AYPIEYIP+AKIPC+  H PKNI+LL CDA GVLPPVSKL+ +Q MYHFISGYT+ +AGTE+GV EP ATFS+CFG  F+ LHP KYA MLAEKM +H A  WL+NTGW+G SY   G R  L +TR I+DAIH G+L +  Y   P+F L+ P  +   VP+ +L+P K WA  E        SL N F + F          K +Q    E+ LA+GP
Sbjct:  270 SDHGVFNIEGGCYAKCLGLSAEKEPEIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENF----------KTYQDKATEQVLAAGP 541          
BLAST of DY259738 vs. ExPASy Swiss-Prot
Match: PCKA_YEAST (Phosphoenolpyruvate carboxykinase [ATP] OS=Saccharomyces cerevisiae GN=PCK1 PE=1 SV=2)

HSP 1 Score: 319.316 bits (817), Expect = 2.294e-86
Identity = 160/282 (56.74%), Postives = 206/282 (73.05%), Query Frame = 3
Query:   69 SDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGTVLENIVFDEHTREVDYLDKSVTENTRAAYPIEYIPNAKIPCVGP-HPKNIILLACDAFGVLPPVSKLSLEQTMYHFISGYTALVAGTEEGVKEPRATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGS-GNRIKLAFTRRIIDAIHSGTLLEASYTKTPVFGLETPTEIKGVPSEILDPEKTWAGNEGLQGYTP*SLGNPFQKKF*GALGIHRIGKEHQALPERFLASGPLF 908
            SD+GV NIEGGCYAKCI+LS EKEP+I++AIKFG+VLEN+++DE +  VDY D S+TENTR AYPI+YIP+AKIPC+   HPKNIILL CDA GVLPPVSKL+ EQ MYHFISGYT+ +AGTE+GV EP  TFS+CFG  F+ LHP +YA MLA KM +H A  +L+NTGW+G SY S G R  L +TR I+D+IH G+L   +Y   P+F L+ PT++ GVP+E+L+P K W+  E        +L N F + F       +I ++ +A P+  LA+GP F
Sbjct:  276 SDHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNF-------KIYQD-RATPD-VLAAGPQF 548          
The following BLAST results are available for this feature:
BLAST of DY259738 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 284
Match NameE-valueIdentityDescription
PCKA_CUCSA3.868e-12680.65Phosphoenolpyruvate carboxykinase [ATP] OS=Cucumis... [more]
PCKA_ARATH1.987e-12276.43Phosphoenolpyruvate carboxykinase [ATP] OS=Arabido... [more]
PCKA_MAIZE2.685e-11976.43Phosphoenolpyruvate carboxykinase [ATP] OS=Zea may... [more]
PCKA1_UROPA3.507e-11975.71Phosphoenolpyruvate carboxykinase [ATP] 1 OS=Uroch... [more]
PCKA2_UROPA1.740e-11875.71Phosphoenolpyruvate carboxykinase [ATP] 2 OS=Uroch... [more]
PCKA_DICDI4.467e-9065.96Phosphoenolpyruvate carboxykinase [ATP] OS=Dictyos... [more]
PCKA_ASHGO2.895e-8961.57Phosphoenolpyruvate carboxykinase [ATP] OS=Ashbya ... [more]
PCKA_CANGA2.451e-8863.29Phosphoenolpyruvate carboxykinase [ATP] OS=Candida... [more]
PCKA_KLULA2.075e-8757.80Phosphoenolpyruvate carboxykinase [ATP] OS=Kluyver... [more]
PCKA_YEAST2.294e-8656.74Phosphoenolpyruvate carboxykinase [ATP] OS=Sacchar... [more]

Pages

back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YA18FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259738 ID=DY259738|Name=DY259738|organism=Citrus clementina|type=EST|length=1040bp
GATAATGGAGTATCTTTCCAGCAGTGCTCATCATCTCCAATTAAGTACCG
GTTATGATCAGTAGACAGAGTGATAATGGAGTATCAAACATTGAAGGCGG
GTGCTATGCCAAATGCATTGATCTTTCAAGGGAGAAGGAGCCTGATATCT
GGAATGCCATCAAATTCGGGACTGTGCTAGAAAACATTGTGTTTGATGAG
CATACACGAGAAGTGGACTACTTGGACAAATCTGTCACGGAGAACACTCG
TGCCGCGTATCCCATAGAGTATATCCCAAATGCAAAGATACCTTGTGTTG
GCCCTCATCCAAAGAATATAATCCTTTTGGCTTGTGATGCATTTGGTGTA
CTCCCACCTGTGAGCAAGTTGAGCTTGGAACAGACCATGTACCACTTCAT
CAGTGGCTACACTGCTCTGGTTGCTGGAACAGAGGAAGGTGTGAAGGAGC
CACGGGCAACATTCTCAGCCTGTTTTGGTGCCGCATTTATAATGCTACAC
CCTACAAAGTATGCTGCCATGCTGGCTGAAAAAATGCAGAAGCATGGGGC
TACTGGATGGTTGGTTAACACTGGCTGGTCAGGTGGAAGCTATGGGTCAG
GAAATCGTATTAAATTAGCTTTTACGAGAAGAATCATTGATGCAATACAT
TCTGGGACTCTTTTGGAGGCAAGCTACACAAAGACTCCAGTTTTTGGGCT
TGAGACCCCAACTGAGATAAAGGGAGTGCCCTCAGAAATCCTGGATCCAG
AAAAAACATGGGCCGGAAATGAAGGGCTACAGGGATACACTCCTTGAAGC
CTAGGAAACCCTTTTCAAAAAAAATTTTGAGGGGCTTTGGGAATCCACAG
AATTGGAAAGGAACACCAAGCCTTACCGGAGAGATTCCTGGCATCCGGCC
CCCTTTTCCTAATCAAAAGTCTTCAAAAACGAACCGGGGCGCCCAGGGGA
CACCAAAAAAATAAAAAAAAACCTTATTTCGCCAAGGCGAGCCATACGTG
TGGGTAAAACTAAAAAAAGCCCCCCTACCCCCTCCCGGGA
back to top