DY259743

Overview
NameDY259743
Unique NameDY259743
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1042
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DY259743_ssr340 microsatellite DY259743_ssr340:340..351. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig1295 contig Ccv1_Contig1295:1..1042. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY259743 vs. ExPASy Swiss-Prot
Match: ATP5E_ARATH (ATP synthase subunit epsilon, mitochondrial OS=Arabidopsis thaliana GN=At1g51650 PE=1 SV=3)

HSP 1 Score: 83.5741 bits (205), Expect = 1.624e-20
Identity = 39/45 (86.67%), Postives = 42/45 (93.33%), Query Frame = 3
Query:   72 MDSNAAVPFWRAAGMRYISYSNICANLVRNCLKEP*KSEALTREE 206
            M SNAAVPFWRAAGM YISYSNICAN+VRNCLKEP K+EALTRE+
Sbjct:    1 MASNAAVPFWRAAGMTYISYSNICANIVRNCLKEPHKAEALTREK 45          

HSP 2 Score: 37.7354 bits (86), Expect = 1.624e-20
Identity = 16/25 (64.00%), Postives = 17/25 (68.00%), Query Frame = 1
Query:  181 KARPSLARKVHFSISKWTDGIPQKP 255
            KA      KVHFS+SKW DG PQKP
Sbjct:   37 KAEALTREKVHFSLSKWADGKPQKP 61          
BLAST of DY259743 vs. ExPASy Swiss-Prot
Match: ATP5E_IPOBA (ATP synthase subunit epsilon, mitochondrial OS=Ipomoea batatas PE=1 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 1.421e-18
Identity = 35/45 (77.78%), Postives = 42/45 (93.33%), Query Frame = 3
Query:   72 MDSNAAVPFWRAAGMRYISYSNICANLVRNCLKEP*KSEALTREE 206
            M SNAAVPFWRAAGM YI+YSN+CAN+VRNCLKEP ++EAL+RE+
Sbjct:    1 MASNAAVPFWRAAGMTYITYSNLCANMVRNCLKEPYRAEALSREK 45          

HSP 2 Score: 35.8094 bits (81), Expect = 1.421e-18
Identity = 14/18 (77.78%), Postives = 15/18 (83.33%), Query Frame = 1
Query:  205 KVHFSISKWTDGIPQKPS 258
            KVHFS SKW DG PQKP+
Sbjct:   45 KVHFSFSKWVDGKPQKPA 62          
BLAST of DY259743 vs. ExPASy Swiss-Prot
Match: ATP5E_MAIZE (ATP synthase subunit epsilon, mitochondrial OS=Zea mays PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 7.323e-17
Identity = 34/43 (79.07%), Postives = 37/43 (86.05%), Query Frame = 3
Query:   78 SNAAVPFWRAAGMRYISYSNICANLVRNCLKEP*KSEALTREE 206
            + AAVPFWRAAGM YI YSNICA LVRNCLKEP KSEA +RE+
Sbjct:    4 TTAAVPFWRAAGMTYIGYSNICAALVRNCLKEPFKSEAASREK 46          

HSP 2 Score: 36.1946 bits (82), Expect = 7.323e-17
Identity = 15/26 (57.69%), Postives = 19/26 (73.08%), Query Frame = 1
Query:  181 KARPSLARKVHFSISKWTDGIPQKPS 258
            K+  +   KVHFSISKWTDG  +KP+
Sbjct:   38 KSEAASREKVHFSISKWTDGKQEKPT 63          
The following BLAST results are available for this feature:
BLAST of DY259743 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
ATP5E_ARATH1.624e-2086.67ATP synthase subunit epsilon, mitochondrial OS=Ara... [more]
ATP5E_IPOBA1.421e-1877.78ATP synthase subunit epsilon, mitochondrial OS=Ipo... [more]
ATP5E_MAIZE7.323e-1779.07ATP synthase subunit epsilon, mitochondrial OS=Zea... [more]
back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YA23FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259743 ID=DY259743|Name=DY259743|organism=Citrus clementina|type=EST|length=1042bp
TCGTTTTCCCCCCCTAGCTGACGGCAACCCACAAAGAGAGAGCAAGAGAG
AAAGAAGAAAGAAAAAAGCAAATGGATTCAAACGCCGCGGTGCCGTTTTG
GAGAGCAGCGGGGATGAGATACATATCGTACTCGAACATCTGTGCGAATC
TGGTGAGGAATTGTCTCAAGGAACCTTAAAAAAGCGAGGCCCTCACTCGC
GAGGAAGGTTCACTTCTCTATCTCTAAATGGACCGATGGCATACCCCAGA
AACCCAGTAAGCATTTTTTTGGTTTATTTAGATCTGCTTTCACATCACAT
TTGCTGTGTTTGTCTTGTATGAAAAAACTGGTGTTCCGAATTTATTTATT
TTTTTATTAATTTCTTGGCTTTCAATTCTGGGGTTTGGGAAAAAAGAAAA
TTTTCACTAAGTGGGGGGGTTAAAAAATGAAAATGTTAGCGATATCTAAA
TCTCAGATATGAAGTAATGGATGATTTGGGCTTGGTTTGTTTGTAAATTT
TGTAAGTGGAGTGCATATGGGGTGGTTTGTGTAAGGAATTTCGTGGTAAC
GGTCAGTTGGATTGGTAAGTAGGATTGTTAAGAGAGGATGATTTTTTTGG
GAAGTGCGGGGGGGGGAGGTTTTAAAAGAGAAGATTTTGCTCTGGAATGA
GCAAATTTGGAGGTAAGGGCGTGATAAAATAATAGAATAGTTTGGGAGGG
AATAAAGGGACACAAAAAAAAAAATGTTTAATGGGTGTAAAAAGGAGTGG
GAAAGGAAGCAATAAAGTGGCTGAGTGGGATTTTTAAAAGGGAGGTGGGG
GAGGCAAATTTATTTATATATTAGGTTTTATAAATTTGAAGATGGAAAAA
AGGAAGTGTAAGTGGGGACTTCAGTGGGTATTTTTAAATAAAATTGAATA
GGGATAGTTTGGTTTTGATAGAGTTGGTAGAACAATGAGGTTAGGGGGGA
TTGAGAGTGTTTGGGGGGAGGAGGTTATGCGACGTACAAAAGAGAGGGAG
GAAAGAGGAGCCGTGGTGGTATAATGAGAAAGAAAAAGATGA
back to top