DY259744

Overview
NameDY259744
Unique NameDY259744
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length983
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DY259744_ssr284 microsatellite DY259744_ssr284:284..295. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DY259744 vs. ExPASy Swiss-Prot
Match: RLA1_MAIZE (60S acidic ribosomal protein P1 OS=Zea mays GN=RPP1A PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 7.689e-20
Identity = 45/62 (72.58%), Postives = 56/62 (90.32%), Query Frame = 2
Query:   74 AGEQACTYATLILHDDGIAVTAEKIAALVKAANVQIESYWPSLFAKLAEKKNLDDLILNVGS 259
            +GE AC YA LIL DDGIA+TAEKIA +VKAAN+++ESYWP+LFAKL EK+N++DLIL+VGS
Sbjct:    3 SGELACRYAALILSDDGIAITAEKIATIVKAANIKVESYWPALFAKLLEKRNVEDLILSVGS 64          
BLAST of DY259744 vs. ExPASy Swiss-Prot
Match: RLA11_ARATH (60S acidic ribosomal protein P1-1 OS=Arabidopsis thaliana GN=RPP1A PE=1 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 1.894e-18
Identity = 43/61 (70.49%), Postives = 53/61 (86.89%), Query Frame = 2
Query:   77 GEQACTYATLILHDDGIAVTAEKIAALVKAANVQIESYWPSLFAKLAEKKNLDDLILNVGS 259
            GE AC+YA +IL D+GIA+TA+KIA LVKAA V IESYWP LFAK+AEK+N+ DLI+NVG+
Sbjct:    5 GELACSYAVMILEDEGIAITADKIATLVKAAGVSIESYWPMLFAKMAEKRNVTDLIMNVGA 65          
BLAST of DY259744 vs. ExPASy Swiss-Prot
Match: RLA13_ARATH (60S acidic ribosomal protein P1-3 OS=Arabidopsis thaliana GN=RPP1C PE=1 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 2.473e-18
Identity = 43/61 (70.49%), Postives = 53/61 (86.89%), Query Frame = 2
Query:   77 GEQACTYATLILHDDGIAVTAEKIAALVKAANVQIESYWPSLFAKLAEKKNLDDLILNVGS 259
            GE AC+YA +IL D+GIA+TA+KIA LVKAA V IESYWP LFAK+AEK+N+ DLI+NVG+
Sbjct:    5 GELACSYAVMILEDEGIAITADKIATLVKAAGVTIESYWPMLFAKMAEKRNVTDLIMNVGA 65          
BLAST of DY259744 vs. ExPASy Swiss-Prot
Match: RLA12_ARATH (60S acidic ribosomal protein P1-2 OS=Arabidopsis thaliana GN=RPP1B PE=1 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 2.473e-18
Identity = 42/61 (68.85%), Postives = 54/61 (88.52%), Query Frame = 2
Query:   77 GEQACTYATLILHDDGIAVTAEKIAALVKAANVQIESYWPSLFAKLAEKKNLDDLILNVGS 259
            GE AC+YA +IL D+GIA+T++KIA LVKAA V+IESYWP LFAK+AEK+N+ DLI+NVG+
Sbjct:    5 GELACSYAVMILEDEGIAITSDKIATLVKAAGVEIESYWPMLFAKMAEKRNVTDLIMNVGA 65          
BLAST of DY259744 vs. ExPASy Swiss-Prot
Match: RLA1_CHLRE (60S acidic ribosomal protein P1 OS=Chlamydomonas reinhardtii PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 5.157e-16
Identity = 38/60 (63.33%), Postives = 48/60 (80.00%), Query Frame = 2
Query:   80 EQACTYATLILHDDGIAVTAEKIAALVKAANVQIESYWPSLFAKLAEKKNLDDLILNVGS 259
            E ACTYA LILHDDG+ +TA+ I  + KAA V++E YWP+LFAKL  KK++DDLI NVG+
Sbjct:    5 ELACTYAALILHDDGLEITADNINTICKAAGVEVEGYWPALFAKLFAKKSMDDLITNVGA 64          
BLAST of DY259744 vs. ExPASy Swiss-Prot
Match: RLA1_DROME (60S acidic ribosomal protein P1 OS=Drosophila melanogaster GN=RpLP1 PE=1 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 8.234e-14
Identity = 37/60 (61.67%), Postives = 45/60 (75.00%), Query Frame = 2
Query:   80 EQACTYATLILHDDGIAVTAEKIAALVKAANVQIESYWPSLFAKLAEKKNLDDLILNVGS 259
            E AC YA+LIL DD +AVT EKI  ++KAANV++E YWP LFAK  E  N+ DLI N+GS
Sbjct:    6 ELACVYASLILVDDDVAVTGEKINTILKAANVEVEPYWPGLFAKALEGINVKDLITNIGS 65          
BLAST of DY259744 vs. ExPASy Swiss-Prot
Match: RLA1_CAEEL (60S acidic ribosomal protein P1 OS=Caenorhabditis elegans GN=rla-1 PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 3.459e-12
Identity = 35/60 (58.33%), Postives = 43/60 (71.67%), Query Frame = 2
Query:   80 EQACTYATLILHDDGIAVTAEKIAALVKAANVQIESYWPSLFAKLAEKKNLDDLILNVGS 259
            E AC YA LIL DD +A+T EKIA L+KAANV+ E YWP LFAK  E  ++ +LI +V S
Sbjct:    6 ELACVYAALILQDDEVAITGEKIATLLKAANVEFEPYWPGLFAKALEGVDVKNLITSVSS 65          
BLAST of DY259744 vs. ExPASy Swiss-Prot
Match: RLA1_RAT (60S acidic ribosomal protein P1 OS=Rattus norvegicus GN=Rplp1 PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 7.706e-12
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 2
Query:   80 EQACTYATLILHDDGIAVTAEKIAALVKAANVQIESYWPSLFAKLAEKKNLDDLILNVGS 259
            E AC Y+ LILHDD + VT +KI AL+KAA V +E +WP LFAK     N+  LI NVG+
Sbjct:    6 ELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGA 65          
BLAST of DY259744 vs. ExPASy Swiss-Prot
Match: RLA1_MOUSE (60S acidic ribosomal protein P1 OS=Mus musculus GN=Rplp1 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 7.706e-12
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 2
Query:   80 EQACTYATLILHDDGIAVTAEKIAALVKAANVQIESYWPSLFAKLAEKKNLDDLILNVGS 259
            E AC Y+ LILHDD + VT +KI AL+KAA V +E +WP LFAK     N+  LI NVG+
Sbjct:    6 ELACIYSALILHDDEVTVTEDKINALIKAAGVSVEPFWPGLFAKALANVNIGSLICNVGA 65          
BLAST of DY259744 vs. ExPASy Swiss-Prot
Match: RLA1_HUMAN (60S acidic ribosomal protein P1 OS=Homo sapiens GN=RPLP1 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 7.706e-12
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 2
Query:   80 EQACTYATLILHDDGIAVTAEKIAALVKAANVQIESYWPSLFAKLAEKKNLDDLILNVGS 259
            E AC Y+ LILHDD + VT +KI AL+KAA V +E +WP LFAK     N+  LI NVG+
Sbjct:    6 ELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGA 65          
The following BLAST results are available for this feature:
BLAST of DY259744 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
RLA1_MAIZE7.689e-2072.5860S acidic ribosomal protein P1 OS=Zea mays GN=RPP... [more]
RLA11_ARATH1.894e-1870.4960S acidic ribosomal protein P1-1 OS=Arabidopsis t... [more]
RLA13_ARATH2.473e-1870.4960S acidic ribosomal protein P1-3 OS=Arabidopsis t... [more]
RLA12_ARATH2.473e-1868.8560S acidic ribosomal protein P1-2 OS=Arabidopsis t... [more]
RLA1_CHLRE5.157e-1663.3360S acidic ribosomal protein P1 OS=Chlamydomonas r... [more]
RLA1_DROME8.234e-1461.6760S acidic ribosomal protein P1 OS=Drosophila mela... [more]
RLA1_CAEEL3.459e-1258.3360S acidic ribosomal protein P1 OS=Caenorhabditis ... [more]
RLA1_RAT7.706e-1255.0060S acidic ribosomal protein P1 OS=Rattus norvegic... [more]
RLA1_MOUSE7.706e-1255.0060S acidic ribosomal protein P1 OS=Mus musculus GN... [more]
RLA1_HUMAN7.706e-1255.0060S acidic ribosomal protein P1 OS=Homo sapiens GN... [more]

Pages

back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YB01FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259744 ID=DY259744|Name=DY259744|organism=Citrus clementina|type=EST|length=983bp
CTCAACCGCAGCAGCTCAAGCCAAACGCAGCCTCTCTTAGTGTGCGATTT
TAGAATTATCAATTGCAATAATGGCCGGAGAGCAAGCTTGCACCTACGCC
ACTTTGATTCTCCACGACGATGGAATCGCAGTCACTGCGGAGAAGATCGC
GGCTTTGGTTAAGGCAGCGAATGTGCAAATAGAGTCTTACTGGCCAAGCC
TTTTTGCGAAGTTGGCTGAAAAGAAAAACTTGGATGATCTCATCTTGAAT
GTTGGCTCCGGTGGCGGTGCTGCCGCACCCGTTGCCGCCGCCGCCCCTGC
TGGTGGTGCCGCAGCCGCCGCTCCTGCCGCTGAGGAGAAAAAGGAAGAAC
CTAAGGAAGATAGTGATGATGATATGGGATTCAGTTTGTTTGATTAAGCA
CCGCATTCAGTTGAGTCACAAATTGATACCCATCTTTTTTTCTTCCTGTT
TTTGCCTTTACCGCACTCGCCAGACTGCATCTCAAGAGGTAAAAATCATA
TAATTTAGTCCTTAATTTATGAGTCTACTCACTCCTGTTGTCATCCCTCC
ACCCCGTCCCTCTATTTAGACTACGGACGAATCACTATTCCAATAAAACT
TAAACCTAAAATAGTCCTCATCCTTCTTGCTAGGCATTGGGCACTTACAC
TGTTCCCCCCTATTCTTCTTTATTGAAAGAATACTTTCTATTTATAAAAT
ACTATAAGTGAATACTAACACCCATGCTGTATTCTCTAACACCCACGGAT
AATTCACCAAAATGAACAATACCACGAAGCCAACCCACAGTCACCATATT
AATCTAACACCAATTAATTTCTCATACCTTTTCTGAAACTATTATCACTT
GAATACATATATCAAATTTTCTTGCATATTAAACCCCGCAAAGCGTAACT
ACCCGATTACTACTCTTCTCTCACTCCTCTCCTGTCACCACCCCTCTCAT
CTACCTTCTCCCCAATCTCTTTCTCTCCTCACC
back to top