DY259747

Overview
NameDY259747
Unique NameDY259747
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length936
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY259747 vs. ExPASy Swiss-Prot
Match: TIF6B_ARATH (Protein TIFY 6B OS=Arabidopsis thaliana GN=TIFY6B PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 8.453e-13
Identity = 42/84 (50.00%), Postives = 55/84 (65.48%), Query Frame = 1
Query:   10 PHTVLPTIGSFGGVHESWNNIKTRGSP-QLTIFYAGTVNVFEDISPEKAQAIMLLAGNGSSIAPTMAQPKVQVQAPSSKPTTVD 258
            P ++LP  GS  G  +  ++ K  GSP QLTIFYAG+V V++DISPEKA+AIMLLAGNGSS+    + P+   Q       +VD
Sbjct:  150 PISILPPPGSIVGTTDIRSSSKPIGSPAQLTIFYAGSVCVYDDISPEKAKAIMLLAGNGSSMPQVFSPPQTHQQVVHHTRASVD 233          
The following BLAST results are available for this feature:
BLAST of DY259747 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
TIF6B_ARATH8.453e-1350.00Protein TIFY 6B OS=Arabidopsis thaliana GN=TIFY6B ... [more]
back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YB05FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259747 ID=DY259747|Name=DY259747|organism=Citrus clementina|type=EST|length=936bp
GTTACATCTCCACATACAGTTCTTCCCACCATTGGATCTTTTGGTGGGGT
ACATGAATCATGGAACAATATCAAAACCCGTGGATCTCCTCAGTTGACCA
TCTTTTATGCCGGTACAGTTAATGTCTTTGAAGATATCTCGCCTGAGAAG
GCTCAGGCTATTATGCTATTAGCTGGTAATGGTTCCTCCATTGCTCCAAC
AATGGCGCAACCAAAAGTTCAGGTCCAGGCACCTAGCTCAAAGCCAACAA
CTGTTGATGGTGTTACTGGGAACCACCCTGTAAGCACCCCACCTGGCACT
GGTCGTTCAAGCCCTATATCTGTTCTTCTCATACTGGTACTCAGTCAGCG
AGTGGCTCTACTAGTACTGAAGAACCAATGGCTGCTAAAACAATAGGGTT
GACGACCACTCATATTTGCAAACCGGAGACTCCAAATATGGAGAAGGCAG
TGGGATCTGTTGCTGCAACTGCTGTGACATCTGCTGGACATTCAAACTTT
TACAAGGGCATCCCTCAGGCTCGAAAAGCTTCCTTGGCTCTATTTTTGGA
GAAACGCAAGCAAAGAGTGATGACCGTAGCCCCATACACCATCAACAAAA
AGTAGTCTCCAGAAGGCTCGGTTCTGGAATGCAATGGCTTTAACCACTCT
GTAACCTCGGCAGCATCAATTGATGGTAGCCGAGATAAAATAGTGCCGAA
CTAAAAAGGTAATTTTGCAAATTTTTGTAATATGTTTTAATATTTAAAAA
AATGGTTTTTTTGTTCTTAAAAGAACCTGAACCCTGGAATTTCCTTCGTT
TTTGGACCTAAATTATGTTCTTACTAAATAATTTTTGTAGGGGGGTTTTT
CCCCTAATTTGATTTTCCTGTCAATCCCTACCAACAATTAGATATCCCTT
TGGACCCCTAAAAGTTTATTTGGGTAAAATCTAGGG
back to top