DY259749

Overview
NameDY259749
Unique NameDY259749
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length919
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY259749 vs. ExPASy Swiss-Prot
Match: P5CS_SOLLC (Delta-1-pyrroline-5-carboxylate synthetase OS=Solanum lycopersicum GN=PRO2 PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 2.987e-55
Identity = 112/168 (66.67%), Postives = 128/168 (76.19%), Query Frame = 3
Query:   57 DHTRDFLKNXXXXXXXXXXXXXXXSDXXXXXXXXXXXXEQLKELNSQGFEIILVSSGAVGVGRQRLRYRKLVNSSLADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSSQLLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAVSTRKAPYEVSCSL 560
            D TR F+KN               +D            EQL+ELNSQG+E+ILV+SGAVGVGRQRLRYRKL+NSS  DLQKPQ ELDGKACAAVGQ+ LMALYD+LFSQLDVTS+QLLVTD+DFRD DFR+QL DTV SLL L+VIPIFNENDA+STR+APYE S  +
Sbjct:    5 DSTRAFVKNVKRLIVKVGTAVVTRADGRLALGRLGALCEQLQELNSQGYEVILVTSGAVGVGRQRLRYRKLLNSSFLDLQKPQTELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLVTDNDFRDPDFRRQLNDTVNSLLSLKVIPIFNENDAISTRRAPYEDSSGI 172          
BLAST of DY259749 vs. ExPASy Swiss-Prot
Match: P5CS_ACTDE (Delta-1-pyrroline-5-carboxylate synthetase OS=Actinidia deliciosa PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 3.900e-55
Identity = 113/163 (69.33%), Postives = 127/163 (77.91%), Query Frame = 3
Query:   57 DHTRDFLKNXXXXXXXXXXXXXXXSDXXXXXXXXXXXXEQLKELNSQGFEIILVSSGAVGVGRQRLRYRKLVNSSLADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSSQLLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAVSTRKAPYE 545
            D TR F+K                +D            EQ+ ELNSQGFE+ILV+SGAVGVGRQRLRYRKLVNSS ADLQKPQ ELDGKACAAVGQ+ L+ALYDTLFSQLDVTS+QLLVTD+DFRD +FRKQL +TV+SLL+L+VIPIFNENDAVSTRKAPYE
Sbjct:    5 DSTRAFVKGVKRVIIKVGTAVVTRADGRLALGRLGALCEQIHELNSQGFEVILVTSGAVGVGRQRLRYRKLVNSSFADLQKPQIELDGKACAAVGQNGLLALYDTLFSQLDVTSAQLLVTDNDFRDPEFRKQLTETVESLLNLKVIPIFNENDAVSTRKAPYE 167          
BLAST of DY259749 vs. ExPASy Swiss-Prot
Match: P5CS_VIGAC (Delta-1-pyrroline-5-carboxylate synthetase OS=Vigna aconitifolia PE=2 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 2.528e-54
Identity = 111/173 (64.16%), Postives = 132/173 (76.30%), Query Frame = 3
Query:   42 MESFQDHTRDFLKNXXXXXXXXXXXXXXXSDXXXXXXXXXXXXEQLKELNSQGFEIILVSSGAVGVGRQRLRYRKLVNSSLADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSSQLLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAVSTRKAPYEVSCSL 560
            MES  D +R F+K+                +            EQ+K+LNS G++IILVSSG VG+GRQRLR+RKL+NSS ADLQKPQ ELDGKACAAVGQ+SLMALYDTLF+QLDVTS+QLLVTD+DFRD+DFRKQL +TV+SLL L+VIP+FNENDAVSTRKAPYE S  +
Sbjct:    1 MESAVDPSRGFMKDVKRVIIKVGTAVVTREEGRLAVGRLGALCEQIKQLNSLGYDIILVSSGPVGIGRQRLRFRKLINSSFADLQKPQLELDGKACAAVGQNSLMALYDTLFTQLDVTSAQLLVTDNDFRDKDFRKQLTETVKSLLALKVIPVFNENDAVSTRKAPYEDSSGI 173          
BLAST of DY259749 vs. ExPASy Swiss-Prot
Match: P5CS_ORYSJ (Delta-1-pyrroline-5-carboxylate synthetase OS=Oryza sativa subsp. japonica GN=P5CS PE=2 SV=2)

HSP 1 Score: 207.223 bits (526), Expect = 1.062e-52
Identity = 105/130 (80.77%), Postives = 118/130 (90.77%), Query Frame = 3
Query:  171 EQLKELNSQGFEIILVSSGAVGVGRQRLRYRKLVNSSLADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSSQLLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAVSTRKAPYEVSCSL 560
            EQ+KELNS G+E+ILV+SGAVGVGRQRLRYRKLVNSS ADLQKPQ ELDGKACAAVGQS LMALYD LF+QLDV+SSQLLVTDSDF +  FR+QL +TV+SLLDL+VIPIFNENDA+STRKAPYE S  +
Sbjct:   43 EQVKELNSLGYEVILVTSGAVGVGRQRLRYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFNQLDVSSSQLLVTDSDFENPKFREQLTETVESLLDLKVIPIFNENDAISTRKAPYEDSSGI 172          
BLAST of DY259749 vs. ExPASy Swiss-Prot
Match: P5CS1_ARATH (Delta-1-pyrroline-5-carboxylate synthetase A OS=Arabidopsis thaliana GN=P5CSA PE=1 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.812e-52
Identity = 102/130 (78.46%), Postives = 117/130 (90.00%), Query Frame = 3
Query:  171 EQLKELNSQGFEIILVSSGAVGVGRQRLRYRKLVNSSLADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSSQLLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAVSTRKAPYEVSCSL 560
            EQL ELNS GFE+ILVSSGAVG+GRQRLRYR+LVNSS ADLQKPQ ELDGKACA VGQSSLMA Y+T+F QLDVT++QLLV DS FRD+DFRKQL +TV+S+LDLRVIPIFNENDA+STR+APY+ S  +
Sbjct:   43 EQLAELNSDGFEVILVSSGAVGLGRQRLRYRQLVNSSFADLQKPQTELDGKACAGVGQSSLMAYYETMFDQLDVTAAQLLVNDSSFRDKDFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPYQDSSGI 172          
BLAST of DY259749 vs. ExPASy Swiss-Prot
Match: P5CS_MESCR (Delta-1-pyrroline-5-carboxylate synthetase OS=Mesembryanthemum crystallinum GN=P5CS PE=2 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 1.174e-51
Identity = 107/168 (63.69%), Postives = 123/168 (73.21%), Query Frame = 3
Query:   57 DHTRDFLKNXXXXXXXXXXXXXXXSDXXXXXXXXXXXXEQLKELNSQGFEIILVSSGAVGVGRQRLRYRKLVNSSLADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSSQLLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAVSTRKAPYEVSCSL 560
            D TR F+K+               SD            EQLKELNS G+E+ILV+SGAV  GRQRLR+RKLVNSS ADLQKPQ ELDGKACAAVGQ+ LMALYDTLFSQLD+T++QLLVTD+DFRD  FR QL +TV  LLDL+V+P+ NENDAVSTRKAPYE S  +
Sbjct:    2 DATRAFVKDVKRVVVKVGTAVVTRSDGRLALGRLGSLCEQLKELNSDGYEVILVTSGAVSAGRQRLRFRKLVNSSFADLQKPQVELDGKACAAVGQNGLMALYDTLFSQLDLTAAQLLVTDNDFRDPSFRTQLTETVYQLLDLKVVPVLNENDAVSTRKAPYEDSSGI 169          
BLAST of DY259749 vs. ExPASy Swiss-Prot
Match: P5CS2_ARATH (Delta-1-pyrroline-5-carboxylate synthetase B OS=Arabidopsis thaliana GN=P5CSB PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 1.696e-50
Identity = 98/130 (75.38%), Postives = 116/130 (89.23%), Query Frame = 3
Query:  171 EQLKELNSQGFEIILVSSGAVGVGRQRLRYRKLVNSSLADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSSQLLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAVSTRKAPYEVSCSL 560
            EQL ELNS GFE+ILVSSGAVG+GRQRLRYR+LVNSS ADLQKPQ ELDGKACA VGQSSLMA Y+T+F QLDVT +Q+LVTDS FRD+DFRKQL +TV+++L +RVIP+FNENDA+STR+APY+ S  +
Sbjct:   43 EQLAELNSDGFEVILVSSGAVGLGRQRLRYRQLVNSSFADLQKPQMELDGKACAGVGQSSLMAYYETMFDQLDVTVAQMLVTDSSFRDKDFRKQLSETVKAMLRMRVIPVFNENDAISTRRAPYKDSTGI 172          
BLAST of DY259749 vs. ExPASy Swiss-Prot
Match: P5CS_PONAB (Delta-1-pyrroline-5-carboxylate synthetase OS=Pongo abelii GN=ALDH18A1 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.552e-22
Identity = 57/126 (45.24%), Postives = 83/126 (65.87%), Query Frame = 3
Query:  171 EQLKELNSQGFEIILVSSGAVGVGRQRLRYRKLVNSSLAD-LQKPQNEL--------DGKACAAVGQSSLMALYDTLFSQLDVTSSQLLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAV 521
            EQ+  L +QG E++LV+SGAV  G+QRLR+  L++ S+   L   QN+L        + +ACAA GQS LMALY+ +F+Q  + ++Q+LVT+ DF DE  R+ L  T+  LL + ++PI N NDAV
Sbjct:  100 EQVSVLQNQGREMMLVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAV 225          
BLAST of DY259749 vs. ExPASy Swiss-Prot
Match: P5CS_HUMAN (Delta-1-pyrroline-5-carboxylate synthetase OS=Homo sapiens GN=ALDH18A1 PE=1 SV=2)

HSP 1 Score: 106.301 bits (264), Expect = 2.552e-22
Identity = 57/126 (45.24%), Postives = 83/126 (65.87%), Query Frame = 3
Query:  171 EQLKELNSQGFEIILVSSGAVGVGRQRLRYRKLVNSSLAD-LQKPQNEL--------DGKACAAVGQSSLMALYDTLFSQLDVTSSQLLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAV 521
            EQ+  L +QG E++LV+SGAV  G+QRLR+  L++ S+   L   QN+L        + +ACAA GQS LMALY+ +F+Q  + ++Q+LVT+ DF DE  R+ L  T+  LL + ++PI N NDAV
Sbjct:  100 EQVSVLQNQGREMMLVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAV 225          
BLAST of DY259749 vs. ExPASy Swiss-Prot
Match: P5CS_MOUSE (Delta-1-pyrroline-5-carboxylate synthetase OS=Mus musculus GN=Aldh18a1 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 4.353e-22
Identity = 57/126 (45.24%), Postives = 82/126 (65.08%), Query Frame = 3
Query:  171 EQLKELNSQGFEIILVSSGAVGVGRQRLRYRKLVNSSLAD-LQKPQNEL--------DGKACAAVGQSSLMALYDTLFSQLDVTSSQLLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAV 521
            EQ+  L +QG E++LV+SGAV  G+QRLR+  L++ S+   L   QN L        + +ACAA GQS LMALY+ +F+Q  + ++Q+LVT+ DF DE  R+ L  T+  LL + ++PI N NDAV
Sbjct:  100 EQVSVLQNQGREMMLVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNHLKEMAIPVLEARACAAAGQSGLMALYEAMFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAV 225          
The following BLAST results are available for this feature:
BLAST of DY259749 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 271
Match NameE-valueIdentityDescription
P5CS_SOLLC2.987e-5566.67Delta-1-pyrroline-5-carboxylate synthetase OS=Sola... [more]
P5CS_ACTDE3.900e-5569.33Delta-1-pyrroline-5-carboxylate synthetase OS=Acti... [more]
P5CS_VIGAC2.528e-5464.16Delta-1-pyrroline-5-carboxylate synthetase OS=Vign... [more]
P5CS_ORYSJ1.062e-5280.77Delta-1-pyrroline-5-carboxylate synthetase OS=Oryz... [more]
P5CS1_ARATH1.812e-5278.46Delta-1-pyrroline-5-carboxylate synthetase A OS=Ar... [more]
P5CS_MESCR1.174e-5163.69Delta-1-pyrroline-5-carboxylate synthetase OS=Mese... [more]
P5CS2_ARATH1.696e-5075.38Delta-1-pyrroline-5-carboxylate synthetase B OS=Ar... [more]
P5CS_PONAB2.552e-2245.24Delta-1-pyrroline-5-carboxylate synthetase OS=Pong... [more]
P5CS_HUMAN2.552e-2245.24Delta-1-pyrroline-5-carboxylate synthetase OS=Homo... [more]
P5CS_MOUSE4.353e-2245.24Delta-1-pyrroline-5-carboxylate synthetase OS=Mus ... [more]

Pages

back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YB07FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259749 ID=DY259749|Name=DY259749|organism=Citrus clementina|type=EST|length=919bp
CTTTTCCTTCTTCCTCTCCCCCACACAAAAACACACACATGATGGAATCT
TTCCAAGATCATACTCGTGACTTCCTCAAGAACGTCAAGCGTGTTGTTGT
TAAGGTTGGAACAGCTGTGGTTACTCGAAGTGATGGACGATTAGCTTTGG
GAAGGCTTGGAGCTCTTTTAGAGCAGCTTAAAGAGTTAAATTCTCAAGGC
TTTGAGATTATTTTAGTTTCTTCAGGCGCTGTTGGTGTTGGCCGCCAAAG
GCTTAGATACAGAAAATTGGTCAATAGCAGCTTGGCTGATCTCCAAAAGC
CGCAGAATGAGCTTGATGGGAAGGCTTGTGCCGCAGTTGGGCAGAGTAGT
CTCATGGCTCTTTATGATACCTTGTTCAGCCAGCTTGATGTGACCTCATC
CCAACTTCTTGTGACGGATAGTGATTTTAGGGATGAAGATTTCAGAAAGC
AACTCTATGACACTGTTCAATCATTGTTAGATTTGAGGGTTATTCCTATT
TTTAATGAAAATGACGCAGTTAGTACTAGGAAAGCACCATACGAGGTATC
TTGTTCCCTTCTGAATTAAAAATGAAACTTCCTGTGCATTTTTTTTTATT
AAAAATTCCTTTTCTTCCCCCTTGGGAATATTGAAATTTCCTTTTTCCTC
CCTTTTGGGACCTAAGGGGTTTGCCTACCTAGGTGAAATTTGTCCCCTTG
TGGAATATTTCTTATTCTTTATATTTAATTTCCATAAAAAACAAAAAACC
CAAGTGAAAAAAAAAAAACAAAAAAAACAAACCCAACCTTTCCTGCAAAA
ACCTCGGCAATACAAAAACTTTCTTCTTTACTTCTTTCTCCACCAACGGG
CCATTATAATACAATATAAACCCTCATTAACCATCGCACTCGTAATCCTC
AGAGCGCGTTCCCATTTGT
back to top