DY259750

Overview
NameDY259750
Unique NameDY259750
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length827
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig1296 contig Ccv1_Contig1296:1..827. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY259750 vs. ExPASy Swiss-Prot
Match: HS26M_ARATH (26.5 kDa heat shock protein, mitochondrial OS=Arabidopsis thaliana GN=HSP26.5 PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.356e-32
Identity = 86/183 (46.99%), Postives = 112/183 (61.20%), Query Frame = 2
Query:   59 MALARLALRNVQQRVSTSSPSLANLHNNLGERSASTIGGVQRQKWSNELLKRFMATAAND-EKKQDREVAVTEKXXXXXXXXXXXXXXXXXNND------IPVLAEFFPSGLGNALMQATENINRIFENLNFTPSQLMGRVKEQDHCYKLRYDVPGLXKDDVKITIHDGVLTIRVSPRKKRRK 586
            MALARLALRN+QQ++S   PSL      +G+   S   G+   + +   L RFMAT+A + E K + EV+V+EK                  N        P L EFFP  +GN L+QATEN+NRIF+N N  P QLMG+VKEQD CYKLRY+VPGL K+DVKIT++DG+LTI+   + +  K
Sbjct:    1 MALARLALRNLQQKLS---PSL------MGQ---SCERGLVGNRHNPMKLNRFMATSAGEQEDKMNTEVSVSEKKSPRQNFPRRRGRKSLWRNTDDHGYFTPTLNEFFPPTIGNTLIQATENMNRIFDNFNVNPFQLMGQVKEQDDCYKLRYEVPGLTKEDVKITVNDGILTIKGDHKAEEEK 171          
The following BLAST results are available for this feature:
BLAST of DY259750 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
HS26M_ARATH1.356e-3246.9926.5 kDa heat shock protein, mitochondrial OS=Arab... [more]
back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YB08FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259750 ID=DY259750|Name=DY259750|organism=Citrus clementina|type=EST|length=827bp
GAGGACTAAAGACGAACAACCCAATTTCTCAAAAAACTCCCCTAGTTACC
GAAAAAAAATGGCTTTGGCTCGTTTGGCTTTGAGGAACGTGCAGCAAAGG
GTGTCAACTTCTTCCCCTTCTCTGGCAAATTTGCATAATAATCTTGGTGA
GAGAAGTGCTAGTACCATCGGTGGTGTACAAAGGCAAAAGTGGAGTAATG
AGTTGTTGAAGAGGTTCATGGCAACAGCTGCCAATGATGAGAAAAAACAA
GACAGAGAAGTCGCCGTGACTGAAAAAAGATCAAGGCTCTTTCCAAGGAG
AAGAGGCAGGAGGGGGAGTCTTTGGAGGAACAATGACATTCCCGTACTTG
CTGAGTTCTTTCCTTCAGGGCTTGGAAATGCACTCATGCAAGCAACCGAA
AACATTAACAGGATATTCGAAAACTTGAACTTCACACCATCACAACTCAT
GGGGCGGGTGAAAGAGCAAGACCACTGCTACAAGCTGCGGTATGACGTTC
CCGGCCTANGCAAAGATGATGTGAAGATCACCATTCATGATGGGGTTCTG
ACCATAAGGGTGAGCCCCAGGAAAAAGAGAAGGAAAGCCCCGACCACCAA
CACTGGTCCCCAAGGGACAATGGTTACTACAACCCCACGCCCCCCGCGGC
CGGATGAGGCCAAAGCCGACAAAAATTAAGGCCAAATTGAAAAACGGGGG
TTCTAAAATTTTAAATTCCCAGGACCCAAAACCCCACCCGGGAGGGGAAG
GAAGGGAAAAACCCCTTTGGGAAGGGGCTTTTTCCCGGGCCCGGGGAATT
TTTTTGGGGGGGTTTTTGGGTTGTTTT
back to top