DY260161

Overview
NameDY260161
Unique NameDY260161
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1037
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9470 contig Ccv1_Contig9470:52..1088. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY260161 vs. ExPASy Swiss-Prot
Match: 1433D_SOYBN (14-3-3-like protein D OS=Glycine max GN=GF14D PE=2 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 1.018e-110
Identity = 203/258 (78.68%), Postives = 221/258 (85.66%), Query Frame = 1
Query:   28 MASSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVLYYEIMNSPERACHLAKQAFDEAISELDPPHEESYQDRTLIMQLLRDHLTLWTSDLPERWRKCPEGQWPCPSWGGE 801
            M +SK+RENFVY+AKLAEQAERY+EMV++MKNVA LDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEE KGNE+NAKRIKEYRQKVE ELS+ICND+M VIDEHLIPSA+AGESTVF+YKMKGDYYRYLAEFK G+EKKEAA  SMK           DLPPTHPIRLGLALNFSV YYEI+NSPERACHLAKQAFDEAISELD  +EESY+D TLIMQLLRD+LTLWTSD+PE      +        GGE
Sbjct:    1 MTASKDRENFVYIAKLAEQAERYEEMVESMKNVANLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEETKGNELNAKRIKEYRQKVELELSNICNDVMRVIDEHLIPSAAAGESTVFYYKMKGDYYRYLAEFKSGNEKKEAADQSMKAYESATAAAEADLPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDNLTLWTSDIPEDGEDAQKVNGTAKLGGGE 258          
BLAST of DY260161 vs. ExPASy Swiss-Prot
Match: 1433B_VICFA (14-3-3-like protein B OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 2.508e-109
Identity = 197/240 (82.08%), Postives = 217/240 (90.42%), Query Frame = 1
Query:   28 MASSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVLYYEIMNSPERACHLAKQAFDEAISELDPPHEESYQDRTLIMQLLRDHLTLWTSDLPE 747
            MAS+K+RENFVY+AKLAEQAERY+EMVD+MKNVA LDVELT+EERNLLSVGYKNVIGARRASWRILSSIEQKEE+KGN+VNAKRIKEYR KVE+ELS+IC D+M VIDEHLIPSA+AGESTVF+YKMKGDYYRYLAEFK G+EKKEA   SMK           +LPPTHPIRLGLALNFSV YYEI+NSPERACHLAKQAFDEAISELD  +EESY+D TLIMQLLRD+LTLWTSD+PE
Sbjct:    1 MASTKDRENFVYIAKLAEQAERYEEMVDSMKNVANLDVELTIEERNLLSVGYKNVIGARRASWRILSSIEQKEESKGNDVNAKRIKEYRHKVETELSNICIDVMRVIDEHLIPSAAAGESTVFYYKMKGDYYRYLAEFKTGNEKKEAGDQSMKAYESATTAAEAELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDNLTLWTSDIPE 240          
BLAST of DY260161 vs. ExPASy Swiss-Prot
Match: 14339_SOLLC (14-3-3 protein 9 OS=Solanum lycopersicum GN=TFT9 PE=2 SV=2)

HSP 1 Score: 391.349 bits (1004), Expect = 4.729e-108
Identity = 199/258 (77.13%), Postives = 220/258 (85.27%), Query Frame = 1
Query:   28 MASSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVLYYEIMNSPERACHLAKQAFDEAISELDPPHEESYQDRTLIMQLLRDHLTLWTSDLPERWRKCPEGQWPCPSWGGE 801
            MASSKERENFVYVAKLAEQAERYDEMV+AMKNVA +DVELTVEERNLLSVGYKNV+G+RRASWRILSSIEQKEE++GNE N KRIKEY QKVESEL++ICNDIM VID+HLIPS SAGESTVF++KMKGDYYRYLAEFK G++KKE A  S+K           +L PTHPIRLGLALNFSV YYEIMNSPERACHLAKQAFDEAISELD  +E+SY+D TLIMQLLRD+LTLWTSDLPE      +G     + GGE
Sbjct:    1 MASSKERENFVYVAKLAEQAERYDEMVEAMKNVANMDVELTVEERNLLSVGYKNVVGSRRASWRILSSIEQKEESRGNEQNVKRIKEYLQKVESELTNICNDIMVVIDQHLIPSCSAGESTVFYHKMKGDYYRYLAEFKAGNDKKEVAELSLKAYQAATTAAEAELAPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDSLNEDSYKDSTLIMQLLRDNLTLWTSDLPEDAEDAQKGDATNKAGGGE 258          
BLAST of DY260161 vs. ExPASy Swiss-Prot
Match: 1433C_SOYBN (14-3-3-like protein C OS=Glycine max GN=GF14C PE=2 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 8.919e-107
Identity = 196/240 (81.67%), Postives = 216/240 (90.00%), Query Frame = 1
Query:   28 MASSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVLYYEIMNSPERACHLAKQAFDEAISELDPPHEESYQDRTLIMQLLRDHLTLWTSDLPE 747
            MAS+KERENFVYVAKLAEQAERY+EMV+AMKNVA L+VELTVEERNLLSVGYKNV+GARRASWRILSSIEQKEEAKGN+V+ KRIKEYR KVESELS+IC+DIMTVIDE+LIPS+S+GE +VFFYKMKGDYYRYLAEFK GDE+KEAA +SMK           +L  THPIRLGLALNFSV YYEI+NSPERACHLAKQAFDEAISELD   EESY+D TLIMQLLRD+LTLWTSD+PE
Sbjct:    1 MASTKERENFVYVAKLAEQAERYEEMVEAMKNVANLNVELTVEERNLLSVGYKNVVGARRASWRILSSIEQKEEAKGNDVSVKRIKEYRLKVESELSNICSDIMTVIDEYLIPSSSSGEPSVFFYKMKGDYYRYLAEFKSGDERKEAADHSMKAYQLASTTAEAELASTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPE 240          
BLAST of DY260161 vs. ExPASy Swiss-Prot
Match: 14338_SOLLC (14-3-3 protein 8 OS=Solanum lycopersicum GN=TFT8 PE=2 SV=2)

HSP 1 Score: 382.874 bits (982), Expect = 1.682e-105
Identity = 191/248 (77.02%), Postives = 216/248 (87.10%), Query Frame = 1
Query:   28 MASSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVLYYEIMNSPERACHLAKQAFDEAISELDPPHEESYQDRTLIMQLLRDHLTLWTSDLPERWRKCPEG 771
            MASSKERE+ VY+A+LAEQAERYDEMVDAMKNVA LDVELTVEERNLLSVGYKNV+G+RRASWRILSSIEQKE+A+GNE N KRI+ YRQKVESEL+DICN+IMTVIDEHLIPS +AGESTVF+YKMKGDYYRYLAEFK GD+KKE +  S+K           +LP THPIRLGLALNFSV YYEIMNSPERAC LAKQ FDEAISELD  +E++Y+D TLI+QLLRD+LTLWTSD+PE   + P+G
Sbjct:    1 MASSKERESLVYIARLAEQAERYDEMVDAMKNVANLDVELTVEERNLLSVGYKNVVGSRRASWRILSSIEQKEDARGNEQNVKRIQGYRQKVESELTDICNNIMTVIDEHLIPSCTAGESTVFYYKMKGDYYRYLAEFKTGDDKKEVSDLSLKAYQTATTTAEAELPITHPIRLGLALNFSVFYYEIMNSPERACQLAKQVFDEAISELDSLNEDNYKDGTLILQLLRDNLTLWTSDIPEDGEEAPKG 248          
BLAST of DY260161 vs. ExPASy Swiss-Prot
Match: 14339_ARATH (14-3-3-like protein GF14 mu OS=Arabidopsis thaliana GN=GRF9 PE=1 SV=2)

HSP 1 Score: 367.851 bits (943), Expect = 5.600e-101
Identity = 185/240 (77.08%), Postives = 208/240 (86.67%), Query Frame = 1
Query:   28 MASSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVLYYEIMNSPERACHLAKQAFDEAISELDPPHEESYQDRTLIMQLLRDHLTLWTSDLPE 747
            M S KER+ FVY+AKL+EQAERY+EMV++MK+VAKL+V+LTVEERNLLSVGYKNVIG+RRASWRI SSIEQKE  KGN+VN KRIKEY +KVE ELS+IC DIM+V+DEHLIPSAS GESTVFF KMKGDYYRYLAEFK G+E+KEAA  S+K            LPPTHPIRLGLALNFSV YYEIMN+PERACHLAKQAFDEAISELD  +EESY+D TLIMQLLRD+LTLWTSD+ E
Sbjct:    1 MGSGKERDTFVYLAKLSEQAERYEEMVESMKSVAKLNVDLTVEERNLLSVGYKNVIGSRRASWRIFSSIEQKEAVKGNDVNVKRIKEYMEKVELELSNICIDIMSVLDEHLIPSASEGESTVFFNKMKGDYYRYLAEFKSGNERKEAADQSLKAYEIATTAAEAKLPPTHPIRLGLALNFSVFYYEIMNAPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDNLTLWTSDISE 240          
BLAST of DY260161 vs. ExPASy Swiss-Prot
Match: 14312_ARATH (14-3-3-like protein GF14 iota OS=Arabidopsis thaliana GN=GRF12 PE=2 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 2.128e-100
Identity = 182/242 (75.21%), Postives = 207/242 (85.54%), Query Frame = 1
Query:   22 SAMASSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVLYYEIMNSPERACHLAKQAFDEAISELDPPHEESYQDRTLIMQLLRDHLTLWTSDLPE 747
            S+  S KERE FVY+AKL+EQAERYDEMV+ MK VA+++ ELTVEERNLLSVGYKNVIGARRASWRI+SSIEQKEE+KGNE N K+IK YRQKVE EL++IC DI+T+ID+HLIP A++GE+TVF+YKMKGDYYRYLAEFK   E+KEAA  S+K           +LP THPIRLGLALNFSV YYEIMNSPERACHLAKQAFDEAI+ELD   EESY+D TLIMQLLRD+LTLWTSDLPE
Sbjct:    2 SSSGSDKERETFVYMAKLSEQAERYDEMVETMKKVARVNSELTVEERNLLSVGYKNVIGARRASWRIMSSIEQKEESKGNESNVKQIKGYRQKVEDELANICQDILTIIDQHLIPHATSGEATVFYYKMKGDYYRYLAEFKTEQERKEAAEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDLPE 243          
BLAST of DY260161 vs. ExPASy Swiss-Prot
Match: 14337_SOLLC (14-3-3 protein 7 OS=Solanum lycopersicum GN=TFT7 PE=2 SV=2)

HSP 1 Score: 365.155 bits (936), Expect = 3.630e-100
Identity = 181/236 (76.69%), Postives = 206/236 (87.29%), Query Frame = 1
Query:   40 KERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVLYYEIMNSPERACHLAKQAFDEAISELDPPHEESYQDRTLIMQLLRDHLTLWTSDLPE 747
            KERE  VY+A+LAEQAERYDEMV+AMK +AK+DVELTVEERNL+SVGYKNVIGARRASWRILSSIEQKEE+KG+E N KRIK YRQ+VE EL+ IC+DI++VIDEHL+PS++ GESTVF+YKMKGDYYRYLAEFK GD++KEA+  S+K           DL PTHPIRLGLALNFSV YYEI+NSPERACHLAKQAFDEAI+ELD   EESY+D TLIMQLLRD+LTLWTSDL E
Sbjct:    3 KEREKQVYLARLAEQAERYDEMVEAMKAIAKMDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEESKGHEQNVKRIKTYRQRVEDELTKICSDILSVIDEHLVPSSTTGESTVFYYKMKGDYYRYLAEFKAGDDRKEASEQSLKAYEAATATASSDLAPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLSEESYKDSTLIMQLLRDNLTLWTSDLEE 238          
BLAST of DY260161 vs. ExPASy Swiss-Prot
Match: 14311_ARATH (14-3-3-like protein GF14 omicron OS=Arabidopsis thaliana GN=GRF11 PE=2 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 5.997e-95
Identity = 176/235 (74.89%), Postives = 200/235 (85.11%), Query Frame = 1
Query:   43 ERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVLYYEIMNSPERACHLAKQAFDEAISELDPPHEESYQDRTLIMQLLRDHLTLWTSDLPE 747
            ER   VY+AKL EQAERYDEMV+AMK VA LDVELT+EERNLLSVGYKNVIGARRASWRILSSIEQKEE+KGNE NAKRIK+YR KVE ELS IC DI+ VID+HL+P A++GESTVF+YKMKGDY+RYLAEFK G +++EAA  S+K           +L  THPIRLGLALNFSV YYEI+NSPERACHLAK+AFDEAI+ELD  +E+SY+D TLIMQLLRD+LTLWTSDL E
Sbjct:    4 ERAKQVYLAKLNEQAERYDEMVEAMKKVAALDVELTIEERNLLSVGYKNVIGARRASWRILSSIEQKEESKGNEQNAKRIKDYRTKVEEELSKICYDILAVIDKHLVPFATSGESTVFYYKMKGDYFRYLAEFKSGADREEAADLSLKAYEAATSSASTELSTTHPIRLGLALNFSVFYYEILNSPERACHLAKRAFDEAIAELDSLNEDSYKDSTLIMQLLRDNLTLWTSDLEE 238          
BLAST of DY260161 vs. ExPASy Swiss-Prot
Match: 14310_ARATH (14-3-3-like protein GF14 epsilon OS=Arabidopsis thaliana GN=GRF10 PE=2 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 1.336e-94
Identity = 173/235 (73.62%), Postives = 200/235 (85.11%), Query Frame = 1
Query:   43 ERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKXXXXXXXXXXXDLPPTHPIRLGLALNFSVLYYEIMNSPERACHLAKQAFDEAISELDPPHEESYQDRTLIMQLLRDHLTLWTSDLPE 747
            ERE  VY+AKL+EQ ERYDEMV+AMK VA+LDVELTVEERNL+SVGYKNVIGARRASWRILSSIEQKEE+KGN+ N KR+K YR++VE EL+ +CNDI++VID+HLIPS++A ESTVFFYKMKGDYYRYLAEF  G E+KEAA  S++            L PTHP+RLGLALNFSV YYEI+NSPE AC LAKQAFD+AI+ELD  +EESY+D TLIMQLLRD+LTLWTSDL E
Sbjct:    4 EREKQVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEESKGNDENVKRLKNYRKRVEDELAKVCNDILSVIDKHLIPSSNAVESTVFFYKMKGDYYRYLAEFSSGAERKEAADQSLEAYKAAVAAAENGLAPTHPVRLGLALNFSVFYYEILNSPESACQLAKQAFDDAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDLNE 238          
The following BLAST results are available for this feature:
BLAST of DY260161 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 144
Match NameE-valueIdentityDescription
1433D_SOYBN1.018e-11078.6814-3-3-like protein D OS=Glycine max GN=GF14D PE=2... [more]
1433B_VICFA2.508e-10982.0814-3-3-like protein B OS=Vicia faba PE=2 SV=1[more]
14339_SOLLC4.729e-10877.1314-3-3 protein 9 OS=Solanum lycopersicum GN=TFT9 P... [more]
1433C_SOYBN8.919e-10781.6714-3-3-like protein C OS=Glycine max GN=GF14C PE=2... [more]
14338_SOLLC1.682e-10577.0214-3-3 protein 8 OS=Solanum lycopersicum GN=TFT8 P... [more]
14339_ARATH5.600e-10177.0814-3-3-like protein GF14 mu OS=Arabidopsis thalian... [more]
14312_ARATH2.128e-10075.2114-3-3-like protein GF14 iota OS=Arabidopsis thali... [more]
14337_SOLLC3.630e-10076.6914-3-3 protein 7 OS=Solanum lycopersicum GN=TFT7 P... [more]
14311_ARATH5.997e-9574.8914-3-3-like protein GF14 omicron OS=Arabidopsis th... [more]
14310_ARATH1.336e-9473.6214-3-3-like protein GF14 epsilon OS=Arabidopsis th... [more]

Pages

back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP11YI06FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY260161 ID=DY260161|Name=DY260161|organism=Citrus clementina|type=EST|length=1037bp
CCCTAATCTCTTCCTCGGAGATCGGCCATGGCTTCCTCTAAAGAACGCGA
AAACTTCGTCTACGTCGCCAAGCTCGCTGAACAAGCCGAGCGCTACGACG
AGATGGTGGATGCGATGAAAAATGTTGCGAAGCTTGATGTGGAATTGACG
GTTGAGGAGCGCAACTTGCTCTCTGTTGGCTACAAGAATGTAATTGGTGC
TCGAAGAGCATCGTGGAGGATACTTTCGTCAATTGAGCAAAAGGAAGAAG
CGAAAGGGAATGAAGTGAATGCAAAGCGGATCAAGGAGTATAGGCAAAAG
GTTGAATCTGAATTGTCGGACATTTGCAATGATATCATGACTGTCATTGA
TGAGCATCTTATTCCTTCAGCAAGTGCTGGTGAATCAACTGTGTTCTTCT
ATAAGATGAAAGGAGATTATTATCGGTACCTTGCTGAATTCAAGTTTGGC
GATGAGAAGAAAGAGGCTGCTGCTAATTCAATGAAAGCATATGAGACAGC
TACCACTGCTGCAGAGGCTGATTTGCCACCTACACATCCCATCCGATTGG
GTTTGGCTCTGAATTTCTCCGTCCTTTATTATGAGATCATGAATTCTCCT
GAAAGGGCTTGCCATCTTGCCAAACAAGCTTTTGATGAAGCTATTTCCGA
GCTGGACCCCCCTCACGAGGAGTCCTACCAAGACCGCACCTTAATTATGC
AGCTTCTTAGGGACCACCTTACCCTATGGACTTCTGACCTTCCCGAAAGA
TGGAGAAAATGCCCCGAAGGCCAATGGCCCTGCCCCAGCTGGGGGGGGGA
GAAGATGCCCAATTGACCCGGAAAGCCCTCCAGGGATTGCCTTTTGATTG
GGGGAAAAAAGGATGAAACCTTGTAAACCCACCTTAGTGGTTTGCCTAAA
GGGGCCCCTTGGCCCTTTTGCTCGCCGGTATTTCCATTTTAAAAAGTGGC
CTCATGGGGGGACGGGGCTTACTTTTTAGCCCAGGGGTGGGCCCCAAAAA
CCAAATGGGGCCGAACCTTGGCCCCGCCCCCCCCCCA
back to top