DY260174

Overview
NameDY260174
Unique NameDY260174
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1053
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY260174 vs. ExPASy Swiss-Prot
Match: UGPI5_ARATH (Uncharacterized GPI-anchored protein At1g27950 OS=Arabidopsis thaliana GN=At1g27950 PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.817e-30
Identity = 62/100 (62.00%), Postives = 78/100 (78.00%), Query Frame = 3
Query:  165 ECGEYLQKTMACLDFARGKITTPSKECCSAVKGIKDDDPKCLCYIIKEANGGEGDMVKNLGVQVPKLLQLPSACQLKNASTSLCPKLLGLSPSSPDAAIF 464
            EC +  QK   CLDFA GK T PSK+CC AV+ IK+ DPKCLC++I++A  G G  +K+LGVQ  KL+QLP++CQL NAS + CPKLLG+SPSSPDAA+F
Sbjct:   34 ECNQDFQKVTLCLDFATGKATIPSKKCCDAVEDIKERDPKCLCFVIQQAKTG-GQALKDLGVQEDKLIQLPTSCQLHNASITNCPKLLGISPSSPDAAVF 132          
The following BLAST results are available for this feature:
BLAST of DY260174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
UGPI5_ARATH1.817e-3062.00Uncharacterized GPI-anchored protein At1g27950 OS=... [more]
back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP11YI23FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY260174 ID=DY260174|Name=DY260174|organism=Citrus clementina|type=EST|length=1053bp
TTGAAATTCCCCTTACAATAAAAATCATTTATCGCAGCAACCAAGGAAAG
AGGAAAGAGGGCAAAAGAGAGAAGATGATGGGAATGAAAAAAGGGTTTCT
ATGTGGCATATTGTTTGGCTTCCTAGCGTTAAGGGTTGTAACGGCTGATG
ACGCTACAAATAAGGAGTGTGGTGAGTATTTGCAGAAGACGATGGCCTGT
TTGGATTTTGCAAGGGGGAAGATTACGACTCCGTCCAAAGAATGTTGCAG
CGCTGTGAAGGGTATAAAAGACGATGATCCAAAGTGTTTGTGTTATATCA
TCAAGGAGGCTAATGGCGGTGAAGGCGATATGGTTAAGAACTTGGGCGTG
CAGGTGCCTAAGCTGCTTCAGCTTCCATCCGCTTGCCAGTTGAAAAATGC
CAGCACCAGTCTCTGCCCAAAGCTTCTAGGGCTATCTCCTAGCTCTCCAG
ATGCTGCAATATTCACAAATACTTCTTCATCGGCAACTCCAACTACAGCA
GCGGCCGCGGGAACATCAGCATCTGACGGATCGTCTGGGAACATGCACGG
ACCATACCTCCTTGGACCGACGGTGATCATAGCAATGTCTATCTTTTTCT
ATGTGTTCCCAACTGGGTCTGCTTCTTTATGTGCTTAACCACAGCCCATA
TGGCGTCCAAAATTGAGAACTCCCCCCAGTAGTGAAGCCGCCTCCTGTTA
TTCCCTTCCTGCAATGTTGTTTGGACCTTATGACCATGTTCCCTTGTCCT
TCCCGACCCCACGACCTTGTGCCCCCCTGGTGGTTTAAATTTCCCCCGCC
CGTGTTCCGCCTTCCCCCGTTTTCCTCATCTTAACACACAACTCACTTTA
ACCACCAAAACAAAACACAACCCCTCTTCTCCTCCCCCACCTTTGGCCAT
TCACCAAACCTACCTCCTCTCCCCTTTCTGCCCCCCCCCCCCCGCCTCAA
TTCCTCCCAAACAAACAACCAACTTTTCCCGGACCCCCCCCCTAACCCCC
CCTTCACGCAACCCCACCAACCCACCCGCTCCCCCCACCCGTCTCTACGC
CCA
back to top