DY260176

Overview
NameDY260176
Unique NameDY260176
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length895
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14665 contig Ccv1_Contig14665:3..897. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY260176 vs. ExPASy Swiss-Prot
Match: SODC4_MAIZE (Superoxide dismutase [Cu-Zn] 4A OS=Zea mays GN=SODCC.3 PE=2 SV=2)

HSP 1 Score: 236.498 bits (602), Expect = 1.574e-61
Identity = 115/152 (75.66%), Postives = 123/152 (80.92%), Query Frame = 2
Query:   65 MVKAVAVLGGTEGVKGTVSFSQEGDGPTTVSGSLSGLKPGPHGFHVHALGDTTNGCMSTGPHFNPAGKEHGPPEDENRHAXXXXXXXXXXXXTATFTVVDNQIPPFGPNSIIGRAVVVPRDPDDLGKGGHELSKTTGNAGGRVACRIIGPPG 520
            MVKAVAVLG +EGVKGT+ F+QEGDGPTTV+GS+SGLKPG HGFHVHALGDTTNGCMSTGPH+NPA KEHG PEDENRHA             A   V D+QIP  GPNSIIGRAVVV  DPDDLGKGGHELSK+TGNAGGRVAC IIG  G
Sbjct:    1 MVKAVAVLGSSEGVKGTIFFTQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGPHYNPASKEHGAPEDENRHAGDLGNVTAGADGVANINVTDSQIPLTGPNSIIGRAVVVHADPDDLGKGGHELSKSTGNAGGRVACGIIGLQG 152          
BLAST of DY260176 vs. ExPASy Swiss-Prot
Match: SODC_ANACO (Superoxide dismutase [Cu-Zn] OS=Ananas comosus GN=SOD1 PE=2 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 2.686e-61
Identity = 115/152 (75.66%), Postives = 122/152 (80.26%), Query Frame = 2
Query:   65 MVKAVAVLGGTEGVKGTVSFSQEGDGPTTVSGSLSGLKPGPHGFHVHALGDTTNGCMSTGPHFNPAGKEHGPPEDENRHAXXXXXXXXXXXXTATFTVVDNQIPPFGPNSIIGRAVVVPRDPDDLGKGGHELSKTTGNAGGRVACRIIGPPG 520
            MVKAVAVLG +EGVKGT+ F+QEGDGPTTV+GS+SGLKPG HGFHVHALGDTTNGCMSTGPHFNPAG EHG PEDE RHA            T    +VD+QIP  G NSIIGRAVVV  DPDDLGKGGHELSKTTGNAGGRVAC IIG  G
Sbjct:    1 MVKAVAVLGSSEGVKGTIYFTQEGDGPTTVTGSISGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGNEHGAPEDETRHAGDLGNVTVGEDGTVNVNIVDSQIPLSGSNSIIGRAVVVHADPDDLGKGGHELSKTTGNAGGRVACGIIGLQG 152          
BLAST of DY260176 vs. ExPASy Swiss-Prot
Match: SODC1_MESCR (Superoxide dismutase [Cu-Zn] 1 OS=Mesembryanthemum crystallinum GN=SODCC.1 PE=2 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 4.581e-61
Identity = 111/152 (73.03%), Postives = 123/152 (80.92%), Query Frame = 2
Query:   65 MVKAVAVLGGTEGVKGTVSFSQEGDGPTTVSGSLSGLKPGPHGFHVHALGDTTNGCMSTGPHFNPAGKEHGPPEDENRHAXXXXXXXXXXXXTATFTVVDNQIPPFGPNSIIGRAVVVPRDPDDLGKGGHELSKTTGNAGGRVACRIIGPPG 520
            MVKAV VL  +EGV GTV F+QEG GPTTV+G++SGL+PG HGFHVHALGDTTNGCMSTGPHFNPAGKEHG PEDE RHA            TATFT++D+QIP  GPNSI+GRAVVV  DPDDLG+GGHELSK TGNAGGRVAC +IG  G
Sbjct:    1 MVKAVVVLSSSEGVSGTVQFTQEGSGPTTVTGNVSGLRPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDETRHAGDLGNITVGDDGTATFTIIDSQIPLTGPNSIVGRAVVVHADPDDLGRGGHELSKATGNAGGRVACGVIGLQG 152          
BLAST of DY260176 vs. ExPASy Swiss-Prot
Match: SODC_IPOBA (Superoxide dismutase [Cu-Zn] OS=Ipomoea batatas GN=SODCC PE=2 SV=2)

HSP 1 Score: 233.802 bits (595), Expect = 1.021e-60
Identity = 113/152 (74.34%), Postives = 123/152 (80.92%), Query Frame = 2
Query:   65 MVKAVAVLGGTEGVKGTVSFSQEGDGPTTVSGSLSGLKPGPHGFHVHALGDTTNGCMSTGPHFNPAGKEHGPPEDENRHAXXXXXXXXXXXXTATFTVVDNQIPPFGPNSIIGRAVVVPRDPDDLGKGGHELSKTTGNAGGRVACRIIGPPG 520
            MVKAVAVL  +EGV GT+ FSQEGDGPTTV+G++SGLKPG HGFHVHALGDTTNGCMSTGPHFNPAGKEHG P D+NRHA            TA+FT+ D QIP  G NS+IGRAVVV  DPDDLGKGGHELSK+TGNAGGRVAC IIG  G
Sbjct:    1 MVKAVAVLSSSEGVSGTIFFSQEGDGPTTVTGNVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPGDDNRHAGDLGNITVGEDGTASFTITDKQIPLTGANSVIGRAVVVHGDPDDLGKGGHELSKSTGNAGGRVACGIIGLQG 152          
BLAST of DY260176 vs. ExPASy Swiss-Prot
Match: SODC_PAUKA (Superoxide dismutase [Cu-Zn] OS=Paulownia kawakamii GN=SODCC PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 1.333e-60
Identity = 112/152 (73.68%), Postives = 122/152 (80.26%), Query Frame = 2
Query:   65 MVKAVAVLGGTEGVKGTVSFSQEGDGPTTVSGSLSGLKPGPHGFHVHALGDTTNGCMSTGPHFNPAGKEHGPPEDENRHAXXXXXXXXXXXXTATFTVVDNQIPPFGPNSIIGRAVVVPRDPDDLGKGGHELSKTTGNAGGRVACRIIGPPG 520
            MVK VAVL  +EGV GT+ F+QEGDGPTTV+G++SGLKPGPHGFHVHALGDTTNGC+STGPHFNPAGKEHG P+DE RHA            TA FT+VD QIP  GP+SIIGRAVVV  DPDDLGKGGHELSKTTGN GGRVAC I G  G
Sbjct:    1 MVKGVAVLSSSEGVSGTIYFTQEGDGPTTVTGNVSGLKPGPHGFHVHALGDTTNGCLSTGPHFNPAGKEHGAPDDEVRHAGDLGNVTVGEDGTAAFTIVDKQIPLTGPHSIIGRAVVVHADPDDLGKGGHELSKTTGNTGGRVACGINGLQG 152          
BLAST of DY260176 vs. ExPASy Swiss-Prot
Match: SODC5_MAIZE (Superoxide dismutase [Cu-Zn] 4AP OS=Zea mays GN=SODCC.2 PE=2 SV=2)

HSP 1 Score: 233.417 bits (594), Expect = 1.333e-60
Identity = 113/152 (74.34%), Postives = 122/152 (80.26%), Query Frame = 2
Query:   65 MVKAVAVLGGTEGVKGTVSFSQEGDGPTTVSGSLSGLKPGPHGFHVHALGDTTNGCMSTGPHFNPAGKEHGPPEDENRHAXXXXXXXXXXXXTATFTVVDNQIPPFGPNSIIGRAVVVPRDPDDLGKGGHELSKTTGNAGGRVACRIIGPPG 520
            MVKAVAVLG ++GVKGT+ F+QEGDGPT V+GS+SGLKPG HGFHVHALGDTTNGCMSTGPH+NPA KEHG PEDENRHA             A   V D+QIP  GPNSIIGRAVVV  DPDDLGKGGHELSK+TGNAGGRVAC IIG  G
Sbjct:    1 MVKAVAVLGSSDGVKGTIFFTQEGDGPTAVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGPHYNPASKEHGAPEDENRHAGDLGNVTAGADGVANINVTDSQIPLTGPNSIIGRAVVVHADPDDLGKGGHELSKSTGNAGGRVACGIIGLQG 152          
BLAST of DY260176 vs. ExPASy Swiss-Prot
Match: SODC1_ORYSJ (Superoxide dismutase [Cu-Zn] 1 OS=Oryza sativa subsp. japonica GN=SODCC1 PE=1 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.969e-60
Identity = 114/152 (75.00%), Postives = 121/152 (79.61%), Query Frame = 2
Query:   65 MVKAVAVLGGTEGVKGTVSFSQEGDGPTTVSGSLSGLKPGPHGFHVHALGDTTNGCMSTGPHFNPAGKEHGPPEDENRHAXXXXXXXXXXXXTATFTVVDNQIPPFGPNSIIGRAVVVPRDPDDLGKGGHELSKTTGNAGGRVACRIIGPPG 520
            MVKAV VLG +E VKGT+ F QEGDGPTTV+GS+SGLKPG HGFH+HALGDTTNGCMSTGPH+NPAGKEHG PEDE RHA             A   VVD+QIP  GPNSIIGRAVVV  DPDDLGKGGHELSKTTGNAGGRVAC IIG  G
Sbjct:    1 MVKAVVVLGSSEIVKGTIHFVQEGDGPTTVTGSVSGLKPGLHGFHIHALGDTTNGCMSTGPHYNPAGKEHGAPEDETRHAGDLGNVTAGEDGVANIHVVDSQIPLTGPNSIIGRAVVVHADPDDLGKGGHELSKTTGNAGGRVACGIIGLQG 152          
BLAST of DY260176 vs. ExPASy Swiss-Prot
Match: SODC1_ORYSI (Superoxide dismutase [Cu-Zn] 1 OS=Oryza sativa subsp. indica GN=SODCC1 PE=2 SV=2)

HSP 1 Score: 232.261 bits (591), Expect = 2.969e-60
Identity = 114/152 (75.00%), Postives = 121/152 (79.61%), Query Frame = 2
Query:   65 MVKAVAVLGGTEGVKGTVSFSQEGDGPTTVSGSLSGLKPGPHGFHVHALGDTTNGCMSTGPHFNPAGKEHGPPEDENRHAXXXXXXXXXXXXTATFTVVDNQIPPFGPNSIIGRAVVVPRDPDDLGKGGHELSKTTGNAGGRVACRIIGPPG 520
            MVKAV VLG +E VKGT+ F QEGDGPTTV+GS+SGLKPG HGFH+HALGDTTNGCMSTGPH+NPAGKEHG PEDE RHA             A   VVD+QIP  GPNSIIGRAVVV  DPDDLGKGGHELSKTTGNAGGRVAC IIG  G
Sbjct:    1 MVKAVVVLGSSEIVKGTIHFVQEGDGPTTVTGSVSGLKPGLHGFHIHALGDTTNGCMSTGPHYNPAGKEHGAPEDETRHAGDLGNVTAGEDGVANIHVVDSQIPLTGPNSIIGRAVVVHADPDDLGKGGHELSKTTGNAGGRVACGIIGLQG 152          
BLAST of DY260176 vs. ExPASy Swiss-Prot
Match: SODC_ZANAE (Superoxide dismutase [Cu-Zn] OS=Zantedeschia aethiopica GN=SODCC PE=2 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 8.639e-60
Identity = 111/149 (74.50%), Postives = 122/149 (81.88%), Query Frame = 2
Query:   65 MVKAVAVLGGTEGVKGTVSFSQEGDGPTTVSGSLSGLKPGPHGFHVHALGDTTNGCMSTGPHFNPAGKEHGPPEDENRHAXXXXXXXXXXXXTATFTVVDNQIPPFGPNSIIGRAVVVPRDPDDLGKGGHELSKTTGNAGGRVACRIIG 511
            MVKAVAVL G+EGV+GTV F+QEG+GPTT++GSLSGLKPG HGFHVHALGDTTNGCMSTGPHFNPAGKEHG PED NRHA            T  FTV D+QIP  G NS++GRAVVV  D DDLGKGGHELSKTTGNAGGR+AC +IG
Sbjct:    1 MVKAVAVLTGSEGVQGTVFFAQEGEGPTTITGSLSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDGNRHAGDLGNVTVGEDGTVNFTVTDSQIPLTGLNSVVGRAVVVHADSDDLGKGGHELSKTTGNAGGRLACGVIG 149          
BLAST of DY260176 vs. ExPASy Swiss-Prot
Match: SODC_NICPL (Superoxide dismutase [Cu-Zn] OS=Nicotiana plumbaginifolia GN=SODCC PE=2 SV=2)

HSP 1 Score: 230.72 bits (587), Expect = 8.639e-60
Identity = 112/152 (73.68%), Postives = 122/152 (80.26%), Query Frame = 2
Query:   65 MVKAVAVLGGTEGVKGTVSFSQEGDGPTTVSGSLSGLKPGPHGFHVHALGDTTNGCMSTGPHFNPAGKEHGPPEDENRHAXXXXXXXXXXXXTATFTVVDNQIPPFGPNSIIGRAVVVPRDPDDLGKGGHELSKTTGNAGGRVACRIIGPPG 520
            MVKAVAVL  +EGV GT+ F+Q+GD PTTV+G++SGLKPG HGFHVHALGDTTNGCMSTGPH+NPAGKEHG PEDE RHA            TA+FT+ D QIP  GP SIIGRAVVV  DPDDLGKGGHELSKTTGNAGGRVAC IIG  G
Sbjct:    1 MVKAVAVLSSSEGVSGTIFFTQDGDAPTTVTGNVSGLKPGLHGFHVHALGDTTNGCMSTGPHYNPAGKEHGAPEDEVRHAGDLGNITVGEDGTASFTLTDKQIPLAGPQSIIGRAVVVHADPDDLGKGGHELSKTTGNAGGRVACGIIGLQG 152          
The following BLAST results are available for this feature:
BLAST of DY260176 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 141
Match NameE-valueIdentityDescription
SODC4_MAIZE1.574e-6175.66Superoxide dismutase [Cu-Zn] 4A OS=Zea mays GN=SOD... [more]
SODC_ANACO2.686e-6175.66Superoxide dismutase [Cu-Zn] OS=Ananas comosus GN=... [more]
SODC1_MESCR4.581e-6173.03Superoxide dismutase [Cu-Zn] 1 OS=Mesembryanthemum... [more]
SODC_IPOBA1.021e-6074.34Superoxide dismutase [Cu-Zn] OS=Ipomoea batatas GN... [more]
SODC_PAUKA1.333e-6073.68Superoxide dismutase [Cu-Zn] OS=Paulownia kawakami... [more]
SODC5_MAIZE1.333e-6074.34Superoxide dismutase [Cu-Zn] 4AP OS=Zea mays GN=SO... [more]
SODC1_ORYSJ2.969e-6075.00Superoxide dismutase [Cu-Zn] 1 OS=Oryza sativa sub... [more]
SODC1_ORYSI2.969e-6075.00Superoxide dismutase [Cu-Zn] 1 OS=Oryza sativa sub... [more]
SODC_ZANAE8.639e-6074.50Superoxide dismutase [Cu-Zn] OS=Zantedeschia aethi... [more]
SODC_NICPL8.639e-6073.68Superoxide dismutase [Cu-Zn] OS=Nicotiana plumbagi... [more]

Pages

back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP11YJ01FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY260176 ID=DY260176|Name=DY260176|organism=Citrus clementina|type=EST|length=895bp
TTTCTCTCCACCTTCCCTCCTCATTTTCCTCCCTCCAAGGGGTGTTCTGA
GATCACACAGCACAATGGTGAAAGCAGTTGCAGTTCTTGGTGGAACTGAG
GGTGTCAAGGGAACTGTTTCCTTTTCCCAGGAAGGAGATGGTCCAACAAC
TGTATCAGGAAGCCTCTCTGGTCTCAAGCCTGGTCCTCATGGATTCCATG
TTCATGCTCTTGGAGACACAACAAATGGTTGCATGTCTACCGGACCCCAC
TTTAACCCTGCTGGAAAAGAACATGGACCTCCAGAGGATGAGAATCGTCA
TGCTGGTGACTTAGGAAATGTCAATGTTGGTGATGATGGTACTGCTACTT
TTACAGTTGTTGACAATCAGATTCCTCCTTTCGGACCAAATTCCATTATT
GGAAGGGCTGTTGTAGTCCCACGCGATCCCGATGATCTTGGCAAGGGCGG
TCATGAGCTGAGCAAAACCACTGGAAATGCTGGTGGCAGAGTAGCCTGCC
GCATCATTGGCCCTCCAGGATGAAGCCCCCTCTCCTCCGACAATAATAAA
TTCCTTTGATATGATGTTTTGAGTGGATTATACTCCCTATATGCCTGAGT
GTGACCTTTCCAAAATAATGAACCTTGAATAAAAAAAAACTAAAAACTTT
GTTGTGTAAAAAAAAAAAAAAAAAAAAAACCCCCACTTTCCTGGACAAAT
TTGGCCTTTAAAAAAAAGCTTGGCTAACCATTTTGTTGCCACAAACCGGG
CCCCTTCCTTCAAAAAAAAAATCCTTTTTTTTCCCCCCCCCCCCGAATAC
CCCCCATAAGCGGGGTCCAATACACGGGCCCCACCCGTTTTTCCCGGGGC
CCTCCCGGCCCCTGTTCCTCAAAAATCTTTCAAGGTATACTCCCC
back to top