DY262445

Overview
NameDY262445
Unique NameDY262445
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1204
Libraries
Library NameType
CitNFLcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DY262445_ssr12 microsatellite DY262445_ssr12:12..21. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DY262445 vs. ExPASy Swiss-Prot
Match: AAPC_CENCI (Putative glucose-6-phosphate 1-epimerase OS=Cenchrus ciliaris PE=2 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 2.158e-94
Identity = 181/303 (59.74%), Postives = 210/303 (69.31%), Query Frame = 2
Query:  164 FVEHCKGVNGLEKVVLREVRGCSAEIYLYGGQVISWKNEYGEELLFLSSKATFKHPKPIRGGIPICFPQFANHGSLEKHGFARSRVWSIDPDPPPFSANSSSQACVDLILKHSEEEVKIWPHRYEFRLRITLGPGGDLMLTSRIRNTNTDGKSXXXXXXXXXXXXVSDISEVRVEGLETLDYLDNLKDKERFTEQGDAITFESEVDKVYLSTPTKIAILDHERKRTFVFAERWTSRCGGLESLG*EAKAMADFGDDD-TNICCV*RLLVWKSQYIETGQGMEKKTGKICCSFRYWKGKTDPKK 1069
            F E  K  +GLEKVVLR  R C AEIYLYGGQV SWKN+ GEELLFLSSKA FK PK IRGGIPIC PQF  HG+LE+HGFAR+R WSID DPPP   N + +A VDLIL+ +EE++KIWPH +EFRLR+ LGP GDL LTSRIRNTNTDG+             VSDISEVRVEGLET+DYLDNLK KERFTEQGDAI FESEVDKVYL+ P+KIAI+DHE+K+TFV  +              +AKAM DFGD +  N+ CV    V K   ++ G+    +         Y  G+ DP K
Sbjct:   23 FAELVKTPSGLEKVVLRGARNCCAEIYLYGGQVTSWKNDNGEELLFLSSKAIFKPPKAIRGGIPICLPQFGTHGNLEQHGFARNRFWSIDNDPPPLPVNPAIKAFVDLILRPAEEDLKIWPHSFEFRLRVALGPSGDLSLTSRIRNTNTDGRPFSYTFAYHTYFFVSDISEVRVEGLETMDYLDNLKAKERFTEQGDAIVFESEVDKVYLAAPSKIAIIDHEKKKTFVVTKEGLPDAVVWNPWDKKAKAMQDFGDAEYKNMLCVEPAAVEKPITLKPGEEWRGRIALSAVPSSYCSGQLDPLK 325          
BLAST of DY262445 vs. ExPASy Swiss-Prot
Match: YMY9_YEAST (Glucose-6-phosphate 1-epimerase OS=Saccharomyces cerevisiae GN=YMR099C PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.905e-16
Identity = 57/206 (27.67%), Postives = 86/206 (41.75%), Query Frame = 2
Query:  230 SAEIYLYGGQVISWKNEYGEELLFLSSKATFKHPKPIRGGIPICFPQFANHGS------LEKHGFARSRVWSI----DPDPPPFSANSSSQACVDLILKHSEEEVKIWPHRYEFRLRITLGPGGDLMLTSRIRNTNTDGKSXXXXXXXXXXXXVSDISEVRVEGLETLDYLDNLKDKERFTEQGDAITFESEVDKVYLSTPTKIAI 817
            S  I  YG  V SWK +  EE L+LS+ A     KP+RGGIP+ FP F  + +      L +HG AR+  W        +PP        +         + E  K+WP   ++ L +T+  G D + T+      +  K             + DI    V  L  +   D L  KE + ++   +TF  E D +Y +   + AI
Sbjct:   21 SVHILKYGATVYSWKLK-SEEQLWLSTAAKLDGSKPVRGGIPLVFPVFGKNSTDEHLSKLPQHGLARNSTWEFLGQTKENPPTVQFGLKPEIA-------NPELTKLWP--MDYLLILTVELGSDYLKTAIEVENTSSSKELKFNWLFHTYFRIEDIEGTMVSNLAGMKLYDQLL-KESYVDKHPVVTFNQETDVIYQNVSAERAI 215          

HSP 2 Score: 31.9574 bits (71), Expect = 1.905e-16
Identity = 12/27 (44.44%), Postives = 18/27 (66.67%), Query Frame = 3
Query:  828 RGNGLSYLRKDGLPDAVVWNPWDKKQR 908
            +G  +  L++  LPD VVWNPW +K +
Sbjct:  220 KGVQIHTLKRYNLPDTVVWNPWIEKSQ 246          
BLAST of DY262445 vs. ExPASy Swiss-Prot
Match: YEAD_ECOLI (Putative glucose-6-phosphate 1-epimerase OS=Escherichia coli (strain K12) GN=yeaD PE=1 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 2.885e-14
Identity = 58/201 (28.86%), Postives = 88/201 (43.78%), Query Frame = 2
Query:  233 AEIYLYGGQVISWKNEYGEELLFLSSKATFKHPKPIRGGIPICFPQF--ANHGSLEKHGFARSRVWSIDPDPPPFSANSSSQACVDLILKHSEEEVKIWPHRYEFRLRITLGPGGDLMLTSRIRNTNTDGKSXXXXXXXXXXXXVSDISEVRVEGLETLDYLDNLKDKERFTEQGDAITFESEVDKVYLSTPTKIAILDHE 829
            A   L G  ++SWK    EE+L+LS+   FK+   IRGG+P+C+P F  A    L  HGFAR+  W++           +    +   L  SEE  K WPH +       +G   ++ L S      T                V DI++V V GL    ++D + D +         TF    D+VYL+ P   ++++ E
Sbjct:   38 ASFALQGAHLLSWKPAGEEEVLWLSNNTPFKNGVAIRGGVPVCWPWFGPAAQQGLPAHGFARNLPWTLKS-----HHEDADGVALTFELTQSEETKKFWPHDFTLLAHFRVGKTCEIDLESHGEFETTSA--------LHTYFNVGDIAKVSVSGLGD-RFIDKVNDAKENVLTDGIQTFPDRTDRVYLN-PQDCSVINDE 223          
The following BLAST results are available for this feature:
BLAST of DY262445 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
AAPC_CENCI2.158e-9459.74Putative glucose-6-phosphate 1-epimerase OS=Cenchr... [more]
YMY9_YEAST1.905e-1627.67Glucose-6-phosphate 1-epimerase OS=Saccharomyces c... [more]
YEAD_ECOLI2.885e-1428.86Putative glucose-6-phosphate 1-epimerase OS=Escher... [more]
back to top
Properties
Property NameValue
Genbank descriptionIC0AAA100AA04RM1 CitNFL Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY262445 ID=DY262445|Name=DY262445|organism=Citrus clementina|type=EST|length=1204bp
AAACAAAGGCTTCTCTCTCTCGCTATCCCCATCCGGTTCGGGTATAAAAC
CCGGCGCGCGATTCGATTCATCAATTTCGGTTCGATCCAGTACCACCTCC
ACCGCCACGTCCACCGCCTCCGCCGCCGAAACTAACATGAATTCTCCTTG
CCGGGAGAAGCTCTTCGTGGAGCATTGTAAAGGCGTTAACGGCCTCGAAA
AAGTCGTTTTGCGCGAAGTTCGCGGCTGTTCCGCTGAGATATATCTCTAT
GGGGGACAAGTAATATCTTGGAAGAACGAGTATGGGGAAGAATTGCTTTT
TCTTAGTAGCAAGGCCACTTTTAAGCATCCAAAGCCAATTCGTGGAGGTA
TACCAATATGTTTCCCTCAATTTGCAAATCACGGTTCCCTTGAAAAACAT
GGATTTGCAAGAAGCAGGGTATGGAGCATTGATCCTGATCCCCCACCATT
TTCCGCAAATAGCTCCAGCCAGGCCTGTGTTGATTTAATCCTTAAACACT
CTGAAGAAGAAGTTAAGATCTGGCCTCACAGATATGAGTTTCGTCTAAGG
ATAACTCTTGGACCTGGCGGGGATTTGATGTTGACATCCCGTATCAGAAA
CACAAACACTGATGGAAAATCATTTGCGTTCACATTTGCCTATCACACCT
ATTTTGCTGTTTCTGATATCAGTGAAGTGCGAGTAGAAGGATTGGAGACG
CTTGATTATCTGGACAACTTGAAGGATAAAGAGCGATTCACCGAACAAGG
AGATGCAATAACATTTGAATCAGAAGTAGACAAAGTATATCTGAGTACAC
CTACAAAAATAGCTATTCTAGATCATGAGAGGAAACGGACTTTCGTATTT
GCGGAAAGATGGACTTCCAGATGCGGTGGTCTGGAATCCTTGGGATAAGA
AGCAAAGGCAATGGCTGATTTTGGCGATGATGATACAAACATATGCTGTG
TGTAGAGGCTGCTTGTGTGGAAAAGCCAATATATTGAAACTGGGCAAGGA
ATGGAAAAGAAAACAGGAAAAATCTGCTGTTCCTTCCGTTATTGGAAGGG
AAAAACTGACCCCAAAAAAGATTCCAAAGGAATTAAAAAAAGAAGTCTTA
GCGGGGGCACCAACCATAAGGGAACCCATTGGGGTTCGGGGCACCGGGGG
GGGCCCAGGGGAATCTTTGCCCCAAATTTTTTTAAAAGGGGGAAAAATAT
GGGG
back to top