DY262447

Overview
NameDY262447
Unique NameDY262447
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1303
Libraries
Library NameType
CitNFLcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DY262447_ssr15 microsatellite DY262447_ssr15:15..26. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DY262447 vs. ExPASy Swiss-Prot
Match: RAVL1_ARATH (AP2/ERF and B3 domain-containing transcription repressor TEM1 OS=Arabidopsis thaliana GN=TEM1 PE=1 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 3.118e-102
Identity = 193/276 (69.93%), Postives = 219/276 (79.35%), Query Frame = 1
Query:  181 LCRVGSGASSVILDSEAGVEAESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAAKAYDIAAQRFRGRDAVTNFKQMSCAGTSSDEGDIEMAFLSSHSKSEIVDMLRKHTYNDELEQSKRNYGLDANGKRVIKHGEGDGVATA-FGSDRVLKARDQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGST--------SKGLLLNFEDVTGKVWRFRYSYWNSSQSYVLTKGWSRFGQEKNWKAGDICSFHRSTGGE*QLYIDWK 981
            L R+GSG SSV+LDSE GVE ESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAA +YDIA +RFRGRDAVTNFK      +  D  D E AFL +HSK+EIVDMLRKHTY DE EQS+R + ++ +GKR        G+ TA +G+D VL+AR+ LFEK VTPSDVGKLNRLVIPKQHAEKHFPL + +T        +KG+L+N ED TGKVWRFRYSYWNSSQSYVLTKGWSRF +EKN +AGD+  F RSTG + QLYI WK
Sbjct:   42 LYRMGSGGSSVVLDSENGVETESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAASSYDIAVRRFRGRDAVTNFK------SQVDGNDAESAFLDAHSKAEIVDMLRKHTYADEFEQSRRKF-VNGDGKR-------SGLETATYGNDAVLRAREVLFEKTVTPSDVGKLNRLVIPKQHAEKHFPLPAMTTAMGMNPSPTKGVLINLEDRTGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVCFERSTGPDRQLYIHWK 303          
BLAST of DY262447 vs. ExPASy Swiss-Prot
Match: RAV2_ARATH (AP2/ERF and B3 domain-containing transcription repressor RAV2 OS=Arabidopsis thaliana GN=RAV2 PE=2 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 4.072e-102
Identity = 194/272 (71.32%), Postives = 221/272 (81.25%), Query Frame = 1
Query:  181 LCRVGSGASSVILDSEAGVEAESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAAKAYDIAAQRFRGRDAVTNFKQMSCAGTSSDEGDIEMAFLSSHSKSEIVDMLRKHTYNDELEQSKRN---YGLDANGKRVIKHGEGDGVATAFGSDRVLKARDQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGS--TSKGLLLNFEDVTGKVWRFRYSYWNSSQSYVLTKGWSRFGQEKNWKAGDICSFHRSTGGE*QLYIDWK 981
            L R+GSG SSV+LD E G+E ESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNE+EEAA++YDIAA RFRGRDAV NFK +       ++GD  +AFL +HSK+EIVDMLRKHTY DELEQ+ +      +DANGKR       +G +T   +D+VLK R+ LFEKAVTPSDVGKLNRLVIPKQHAEKHFPL S S   +KG+L+NFEDV GKVWRFRYSYWNSSQSYVLTKGWSRF +EKN +AGD+ +F RSTG E QLYIDWK
Sbjct:   35 LYRMGSGGSSVVLDPENGLETESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEQEEAARSYDIAACRFRGRDAVVNFKNV------LEDGD--LAFLEAHSKAEIVDMLRKHTYADELEQNNKRQLFLSVDANGKR-------NGSSTT-QNDKVLKTREVLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLPSPSPAVTKGVLINFEDVNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVTFERSTGLERQLYIDWK 290          
BLAST of DY262447 vs. ExPASy Swiss-Prot
Match: RAV1_ARATH (AP2/ERF and B3 domain-containing transcription factor RAV1 OS=Arabidopsis thaliana GN=RAV1 PE=1 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 2.470e-99
Identity = 191/271 (70.48%), Postives = 215/271 (79.34%), Query Frame = 1
Query:  181 LCRVGSGASSVILDSEAGVEAESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAAKAYDIAAQRFRGRDAVTNFKQMSCAGTSSDEGDIEMAFLSSHSKSEIVDMLRKHTYNDELEQSKRNYGLDANGKRVIKHG--EGDGVATAFGSDRVLKARDQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGSTS-KGLLLNFEDVTGKVWRFRYSYWNSSQSYVLTKGWSRFGQEKNWKAGDICSFHRSTGGE*QLYIDWKA 984
            L R+GSG SSV+LDSE GVEAESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEE+EAA+AYD+A  RFR RDAVTNFK +       DE +++  FL+SHSKSEIVDMLRKHTYN+ELEQSKR    + N  R +       DGV+T        ++ + LFEKAVTPSDVGKLNRLVIPK HAEKHFPL S + S KG+LLNFEDV GKVWRFRYSYWNSSQSYVLTKGWSRF +EKN +AGD+ SF RS G + QLYI WK+
Sbjct:   33 LYRMGSG-SSVVLDSENGVEAESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEDEAARAYDVAVHRFRRRDAVTNFKDV-----KMDEDEVD--FLNSHSKSEIVDMLRKHTYNEELEQSKRRRNGNGNMTRTLLTSGLSNDGVSTT-----GFRSAEALFEKAVTPSDVGKLNRLVIPKHHAEKHFPLPSSNVSVKGVLLNFEDVNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVSFSRSNGQDQQLYIGWKS 290          
BLAST of DY262447 vs. ExPASy Swiss-Prot
Match: RAVL4_ARATH (AP2/ERF and B3 domain-containing transcription factor ARF14 OS=Arabidopsis thaliana GN=ARF14 PE=2 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 2.096e-90
Identity = 182/276 (65.94%), Postives = 207/276 (75.00%), Query Frame = 1
Query:  181 LCRVGSGASSVILDSEAGVE----AESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAAKAYDIAAQRFRGRDAVTNFKQMSCAGTSSDEGDIEMAFLSSHSKSEIVDMLRKHTYNDELEQSKRNYGLDANGKRVIKHGEGDGVA-TAFGSDRVLKARDQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGSTS---KGLLLNFEDVTGKVWRFRYSYWNSSQSYVLTKGWSRFGQEKNWKAGDICSFHRSTGGE*QLYIDWKA 984
            L R+GSG +SV+LDSE GVE    AESRKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTFNEE+EAA+AYD+AA RFRGRDAVTNFK      T+ +E   E+ FL++HSKSEIVDMLRKHTY +EL+Q KRN   D NGK          V  T F      K  + LFEK VTPSDVGKLNRLVIPK  AEKHFPL  G+ +   KG+LLNFEDV GKVWRFRYSYWNSSQSYVLTKGWSRF +EK   AGD+ SF RS   + + +I WK+
Sbjct:   29 LYRMGSG-TSVVLDSENGVEVEVEAESRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEDEAARAYDVAAHRFRGRDAVTNFKD-----TTFEE---EVEFLNAHSKSEIVDMLRKHTYKEELDQRKRN--RDGNGKETTAFALASMVVMTGF------KTAELLFEKTVTPSDVGKLNRLVIPKHQAEKHFPLPLGNNNVSVKGMLLNFEDVNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKRLCAGDLISFKRSNDQDQKFFIGWKS 287          
BLAST of DY262447 vs. ExPASy Swiss-Prot
Match: Y5498_ORYSJ (AP2/ERF and B3 domain-containing protein Os05g0549800 OS=Oryza sativa subsp. japonica GN=Os05g0549800 PE=2 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 5.907e-85
Identity = 172/294 (58.50%), Postives = 201/294 (68.37%), Query Frame = 1
Query:  181 LCRVGSGASSVILDSEAGVEAESR---------KLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAAKAYDIAAQRFRGRDAVTNFKQMSCAGTSSDEGDIEMAFLSSHSKSEIVDMLRKHTYNDELEQSKRNYGLDANGKRVIKHGEGDGVATAFGSDRVLKARDQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQ------------------SGSTSKGLLLNFEDVTGKVWRFRYSYWNSSQSYVLTKGWSRFGQEKNWKAGDICSFHRSTGGE*QLYIDWK 981
            L RVGSGAS+V+  +E G EA+S          KLPSSKYKGVVPQPNGRWGAQIYE+HQRVWLGTF  E EAA+AYD+AAQRFRGRDAVTNF+ ++    S  E  +E+ FL+S SK+E+VDMLRKHTY +EL Q+KR +   A      KH      +++        AR+ LF+K VTPSDVGKLNRLVIPKQHAEKHFPLQ                   G   KG+LLNFED  GKVW+FRYSYWNSSQSYVLTKGWSRF +EK   AGD   F+R+ G   QL+ID K
Sbjct:   30 LQRVGSGASAVMDAAEPGAEADSGGERRGGGGGKLPSSKYKGVVPQPNGRWGAQIYERHQRVWLGTFTGEAEAARAYDVAAQRFRGRDAVTNFRPLA---ESDPEAAVELRFLASRSKAEVVDMLRKHTYLEELTQNKRAFA--AISPPPPKHPASSPTSSS-------AAREHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPPPTTTSSVAAAADAAAGGGDCKGVLLNFEDAAGKVWKFRYSYWNSSQSYVLTKGWSRFVKEKGLHAGDAVGFYRAAGKNAQLFIDCK 311          
BLAST of DY262447 vs. ExPASy Swiss-Prot
Match: Y1934_ORYSJ (AP2/ERF and B3 domain-containing protein Os01g0693400 OS=Oryza sativa subsp. japonica GN=Os01g0693400 PE=2 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 5.907e-85
Identity = 168/290 (57.93%), Postives = 203/290 (70.00%), Query Frame = 1
Query:  187 RVGSGASSVILDSEAGVEAESR------------------KLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAAKAYDIAAQRFRGRDAVTNFKQMSCAGTSSDEGDIEMAFLSSHSKSEIVDMLRKHTYNDELEQSKRNYGLDANGKRVIKHGEGDG-VATAFGSDRVLKARDQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQ---SGSTSKGLLLNFEDVTGKVWRFRYSYWNSSQSYVLTKGWSRFGQEKNWKAGDICSFHR---STGGE*QLYIDWK 981
            R+GSGAS+V+  +E G EA+S                   KLPSSK+KGVVPQPNGRWGAQIYE+HQRVWLGTF  E++AA+AYD+AAQRFRGRDAVTNF+ ++    +  +   E+ FL++ SK+E+VDMLRKHTY DEL QSKR +               +G +++         ARD LF+K VTPSDVGKLNRLVIPKQHAEKHFPLQ   +G  SKG+LLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRF +EK   AGD+  F+R   S G + +L+ID K
Sbjct:   36 RMGSGASAVVDAAEPGAEADSGSGGRVCGGGGGGAGGAGGKLPSSKFKGVVPQPNGRWGAQIYERHQRVWLGTFAGEDDAARAYDVAAQRFRGRDAVTNFRPLA---EADPDAAAELRFLATRSKAEVVDMLRKHTYFDELAQSKRTFAASTPSAATTTASLSNGHLSSPRSPFAPAAARDHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPSAGGESKGVLLNFEDAAGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKGLHAGDVVGFYRSAASAGDDGKLFIDCK 322          
BLAST of DY262447 vs. ExPASy Swiss-Prot
Match: Y1410_ORYSJ (AP2/ERF and B3 domain-containing protein Os01g0141000 OS=Oryza sativa subsp. japonica GN=Os01g0141000 PE=2 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 1.235e-74
Identity = 155/270 (57.41%), Postives = 181/270 (67.04%), Query Frame = 1
Query:  202 ASSVILDSEAGVEAESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAAKAYDIAAQRFRGRDAVTNFKQMSCAGTSSDEGDIEMAFLSSHSKSEIVDMLRKHTYNDELEQSKRNYGLDANGKRVIKHGEGDGVATAFGSDRVLKARDQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQ---------SGSTSKGLLLNFEDVTGKVWRFRYSYWNSSQSYVLTKGWSRFGQEKNWKAGDICSFHRST-GGE*QLYIDWK 981
            A  V+    A   A+     SS+YKGVVPQPNGRWGAQIYE+H RVWLGTF +EE AA+AYD+AA R+RGRDA TNF   + +         E+AFL++HSK+EIVDMLRKHTY DEL Q              ++ G G G   A        AR+ LFEKAVTPSDVGKLNRLV+PKQHAEKHFPL+         + +T KG+LLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRF +EK  +AGD   F RS  G +  L+ID K
Sbjct:   50 ADEVVTSRPAAAAAQQ----SSRYKGVVPQPNGRWGAQIYERHARVWLGTFPDEEAAARAYDVAALRYRGRDAATNFPGAAASAA-------ELAFLAAHSKAEIVDMLRKHTYADELRQG-------------LRRGRGMG---ARAQPTPSWAREPLFEKAVTPSDVGKLNRLVVPKQHAEKHFPLRRAASSDSASAAATGKGVLLNFEDGEGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLRAGDTIVFSRSAYGPDKLLFIDCK 292          
BLAST of DY262447 vs. ExPASy Swiss-Prot
Match: Y1407_ORYSJ (Putative AP2/ERF and B3 domain-containing protein Os01g0140700 OS=Oryza sativa subsp. japonica GN=Os01g0140700 PE=3 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 5.187e-73
Identity = 160/300 (53.33%), Postives = 184/300 (61.33%), Query Frame = 1
Query:  184 CRVGSGASSVILDSEAGVEAESRKL--------------------------PSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAAKAYDIAAQRFRGRDAVTNFKQMSCAGTSSDEGDIEMAFLSSHSKSEIVDMLRKHTYNDELEQSKRNYGLDANGKRVIKHGEGDGVATAFGSDRVLKARDQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPL-----QSGSTSKGLLLNFEDVTGKVWRFRYSYWNSSQSYVLTKGWSRFGQEKNWKAGDICSFHRST---GGE*QLYIDWK 981
            C  GSG SS   DS+   E E                              PSS+YKGVVPQPNGRWGAQIYE+H RVWLGTF +EE AA+AYD+AA RFRGRDAVTN +  +  G S+ E    +AFL++HSK+E+VDMLRKHTY+DEL+Q  R       G R                     AR+ LFEKAVTPSDVGKLNRLV+PKQ AE+HFP       S +  KG+LLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRF +EK  + GD  +F RS    G E  L ID K
Sbjct:   12 CNSGSGGSSSTTDSKQEEEEEEELAAMEEDELIHVVQAAELRLPSSTTATRPSSRYKGVVPQPNGRWGAQIYERHARVWLGTFPDEEAAARAYDVAALRFRGRDAVTN-RAPAAEGASAGE----LAFLAAHSKAEVVDMLRKHTYDDELQQGLRR------GSRA--------------QPTPRWAREPLFEKAVTPSDVGKLNRLVVPKQQAERHFPFPLRRHSSDAAGKGVLLNFEDGDGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLRPGDTVAFSRSAAAWGTEKHLLIDCK 286          
BLAST of DY262447 vs. ExPASy Swiss-Prot
Match: NGA1_ARATH (B3 domain-containing transcription factor NGA1 OS=Arabidopsis thaliana GN=NGA1 PE=2 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 4.148e-38
Identity = 76/113 (67.26%), Postives = 90/113 (79.65%), Query Frame = 1
Query:  652 RVLKARDQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGSTSKGLLLNFEDVTGKVWRFRYSYWNSSQSYVLTKGWSRFGQEKNWKAGDICSFHR---STGGE*QLYIDWK 981
            R +  R+ +F+K VTPSDVGKLNRLVIPKQHAE+ FPL S S  KGLLLNFED+TGK WRFRYSYWNSSQSYV+TKGWSRF ++K   AGDI SF R    +G + +L+IDW+
Sbjct:   26 REVADREHMFDKVVTPSDVGKLNRLVIPKQHAERFFPLDSSSNEKGLLLNFEDLTGKSWRFRYSYWNSSQSYVMTKGWSRFVKDKKLDAGDIVSFQRCVGDSGRDSRLFIDWR 138          
BLAST of DY262447 vs. ExPASy Swiss-Prot
Match: Y2835_ORYSJ (B3 domain-containing protein Os02g0683500 OS=Oryza sativa subsp. japonica GN=Os02g0683500 PE=2 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 5.990e-37
Identity = 76/124 (61.29%), Postives = 90/124 (72.58%), Query Frame = 1
Query:  619 GDGVATAFGSDRVLKARDQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGSTSKGLLLNFEDVTGKVWRFRYSYWNSSQSYVLTKGWSRFGQEKNWKAGDICSFHRSTGGE---*QLYIDWK 981
            G G     G +  +  ++ +F+K VTPSDVGKLNRLVIPKQ+AEK+FPL + +  KGLLLNFED  GK WRFRYSYWNSSQSYV+TKGWSRF +EK   AGD  SF R  G E    +L+IDWK
Sbjct:   76 GSGGGGGGGGEAEVVEKEHMFDKVVTPSDVGKLNRLVIPKQYAEKYFPLDAAANEKGLLLNFEDRAGKPWRFRYSYWNSSQSYVMTKGWSRFVKEKRLDAGDTVSFSRGIGDEAARHRLFIDWK 199          
The following BLAST results are available for this feature:
BLAST of DY262447 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 28
Match NameE-valueIdentityDescription
RAVL1_ARATH3.118e-10269.93AP2/ERF and B3 domain-containing transcription rep... [more]
RAV2_ARATH4.072e-10271.32AP2/ERF and B3 domain-containing transcription rep... [more]
RAV1_ARATH2.470e-9970.48AP2/ERF and B3 domain-containing transcription fac... [more]
RAVL4_ARATH2.096e-9065.94AP2/ERF and B3 domain-containing transcription fac... [more]
Y5498_ORYSJ5.907e-8558.50AP2/ERF and B3 domain-containing protein Os05g0549... [more]
Y1934_ORYSJ5.907e-8557.93AP2/ERF and B3 domain-containing protein Os01g0693... [more]
Y1410_ORYSJ1.235e-7457.41AP2/ERF and B3 domain-containing protein Os01g0141... [more]
Y1407_ORYSJ5.187e-7353.33Putative AP2/ERF and B3 domain-containing protein ... [more]
NGA1_ARATH4.148e-3867.26B3 domain-containing transcription factor NGA1 OS=... [more]
Y2835_ORYSJ5.990e-3761.29B3 domain-containing protein Os02g0683500 OS=Oryza... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionIC0AAA100AA06RM1 CitNFL Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY262447 ID=DY262447|Name=DY262447|organism=Citrus clementina|type=EST|length=1303bp
ATTCAGCATCCCTCTCTTTCTTTCTTGTACCAGAACCTCTTGTAGACACA
CATAACACACATGAAAAGAGAAGAAATGGACGGAAGTTGCATGGACGAAA
GCACGACAACTGATTCAGCATCAACATCCCCGCCAATAACTTTCCCTCCG
AGCATCCCGCCGACCAAGTCGCCGGAGAGTCTTTGCCGAGTCGGCAGCGG
AGCCTCCAGCGTGATTCTCGACTCGGAAGCCGGCGTGGAGGCTGAGTCGA
GGAAGCTCCCGTCTTCCAAATACAAAGGGGTGGTCCCACAGCCGAATGGG
AGGTGGGGCGCCCAGATATACGAGAAGCACCAAAGGGTCTGGCTCGGCAC
CTTCAACGAGGAAGAGGAAGCTGCCAAGGCCTACGATATCGCTGCGCAGC
GTTTCCGCGGACGCGATGCCGTCACAAACTTCAAGCAAATGTCTTGTGCT
GGAACGTCCTCCGACGAGGGTGATATCGAAATGGCGTTCTTGAGCTCCCA
CTCCAAGTCCGAGATCGTCGATATGCTGAGGAAGCACACTTACAACGACG
AGCTCGAGCAGAGCAAAAGAAACTACGGCCTCGATGCCAACGGCAAGCGT
GTAATCAAACACGGGGAAGGTGATGGTGTTGCCACTGCCTTCGGTTCAGA
CCGGGTCCTTAAAGCGCGTGACCAGCTTTTTGAAAAGGCCGTTACCCCAA
GTGACGTGGGGAAGCTGAACCGGCTCGTGATACCCAAGCAGCACGCGGAG
AAGCACTTCCCTTTACAGAGCGGAAGCACTTCCAAGGGACTGCTCTTGAA
CTTTGAGGATGTCACCGGCAAAGTTTGGAGGTTTAGGTACTCCTACTGGA
ACAGCAGTCAAAGCTACGTTTTGACCAAAGGGTGGAGCCGGTTCGGTCAG
GAGAAGAATTGGAAAGCCGGTGACATTTGTAGCTTTCACAGATCGACCGG
TGGGGAATAGCAGCTTTACATTGATTGGAAAGCCAGAACAGGACGGTCGA
GAACCCGGTCGAGCCCGTCAAAAGAAGAGGCTATTTGGGGTCAACATTTC
AAATTCCGGGGAAGGGTCTTGTTGGTGTCCAAAAAAATGGGGGCAAAATA
AAAAAAAAAACGAACGGCAAAAGGCTTAAAAAAAGGAACCTTTTGGCCTT
TTAAAGGGAACAAAAAAAAAAAAAAAAGAATTGGAAACCTTTCAAAAACT
CTTTTTTTTTTTTTTTTTTTCCTTTTTTTGAAAAAATTATATATTTCTTT
GTTTGGAAAAAATTTTTTTCTTTTTTTTTTTTTTTTTTTTTTTCTTTTTT
TTT
back to top