DY262448

Overview
NameDY262448
Unique NameDY262448
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1334
Libraries
Library NameType
CitNFLcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY262448 vs. ExPASy Swiss-Prot
Match: RTL2_ORYSJ (Ribonuclease 3-like protein 2 OS=Oryza sativa subsp. japonica GN=Os05g0271300 PE=2 SV=2)

HSP 1 Score: 259.996 bits (663), Expect = 2.327e-68
Identity = 149/290 (51.38%), Postives = 188/290 (64.83%), Query Frame = 3
Query:  105 LPSP----EMEDAVFYVENIINYNFKNKRLLEEALTHSSYTD-STSYQRLEFIGDAALGLALSNYVFLAYPQLDPGQLSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFAEAVSQED----NTAVYGGS-IKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIVTLEELQQQPQPVTLLFKLCQKNGKQVDIKHWRKNRKNIASVYVDGSFVASASSEQKEIAKLNAAREALXKLAQSMPVNCDVCEIFDDIDEKFEIEAAKQKLHELXRKEKW 944
            LP P    +  +A   VE ++ Y F++ RLLEEALTH S+ D + SYQRLEF+GD+ALGLA SN+++L  P L PG LS LRAANISTEKLARVAV+H  Y  +R +   LD  V +F E V QE     +T  YGGS +KAPKVLADIVE+IAAA+YVD  FDL+KLW + R L EPI+T E + +  QPVT+L +LCQK+GK    K W+K    + +V+V G  V   SSEQK IAKLNAAR+A  KLA +              DE  E+   KQKL+E   ++ W
Sbjct:   24 LPPPGFVADRAEAAARVERLLRYQFRDGRLLEEALTHQSFADDAVSYQRLEFVGDSALGLAFSNFLYLTNPTLGPGPLSTLRAANISTEKLARVAVRHDLYPLLRRNCPRLDLLVGQFIETVKQEPEDDLSTVPYGGSVVKAPKVLADIVEAIAAAVYVDCKFDLEKLWKVTRWLFEPIITAETIDE--QPVTMLHELCQKHGKMAQFKTWQKGGMTVVNVFVAGELVGIGSSEQKVIAKLNAARDATRKLAGAKKQVLTTGVGNGLGDEIGELRECKQKLNEQCSRQNW 311          
BLAST of DY262448 vs. ExPASy Swiss-Prot
Match: RTL3_ORYSJ (Ribonuclease 3-like protein 3 OS=Oryza sativa subsp. japonica GN=Os06g0358800 PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 8.605e-47
Identity = 111/260 (42.69%), Postives = 161/260 (61.92%), Query Frame = 3
Query:  141 VENIINYNFKNKRLLEEALTHSS----YTDSTSYQRLEFIGDAALGLALSNYVFLAYPQLDPGQLSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFAEAVSQEDNTAVYGGSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIVTLEELQQQPQPVTLLFKLCQKNGKQVDI--KHWRKNRKNIASVYVDGSFVASAS-SEQKEIAKLNAAREALXKL------AQSMPVNCDVCEIFDDID 881
            VE+++ Y F++K L+EEALTH S    Y    +Y+RLE++GDA L   +S  VFL Y QL PG L+ LRAAN+  EKLARVAV HG + F+RH A  LD ++ +F E +S     +   G +  PKVL D+VES+  AIY D +F+ + +W +F+ L +P+++LE L +   PV+ LF+ CQK  + V I    W KN      V +DG  V  A+ +++KEIA+  AA+ AL KL      +Q+ P++ +V E F+ ID
Sbjct:   42 VESLLGYEFRDKALVEEALTHGSFYYPYRPGVTYERLEYLGDAVLTCVVSREVFLTYGQLQPGPLTRLRAANVDKEKLARVAVVHGLHHFLRHKAPNLDGQITDFIEELSMYPIHS--NGLLDPPKVLCDVVESLIGAIYCDSNFNQEIVWQVFQKLADPLISLETLGK--HPVSELFEFCQKTRRGVKIVKDEWDKNL--TVEVLIDGEMVGRATYAQKKEIAQNRAAKAALDKLKETLGQSQTEPMSAEVSEQFNKID 295          
BLAST of DY262448 vs. ExPASy Swiss-Prot
Match: DICER_ARATH (Endoribonuclease Dicer homolog OS=Arabidopsis thaliana GN=CAF PE=1 SV=2)

HSP 1 Score: 172.17 bits (435), Expect = 6.381e-42
Identity = 107/299 (35.79%), Postives = 164/299 (54.85%), Query Frame = 3
Query:  141 VENIINYNFKNKRLLEEALTHSSYTDS--TSYQRLEFIGDAALGLALSNYVFLAYPQLDPGQLSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFAEAVSQEDNTAVYG----GSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIVTLEELQQQPQPVTLLFKLCQKNGKQVDIKHWRKNRKNIASVYVDGSFVASASSEQKEIAKLNAAREAL-----XKLAQSMPVNCDVCEIFDDIDEKFEIEA-------AKQKLHELXRKEKWAQTSLQIEKDXGP 983
            +E  + Y FK K LL EA+TH+S   S  + YQRLEF+GDA L   ++ ++F  Y  L PG+L+ LRAA ++ E  ARVAVKH  + ++RH ++AL+ +++EF + V  E +   +     G  KAPKVL DIVESIA AI++D   D    W +F+ LL+P+VT E L     PV  L + CQ+  + ++ K  R        V++DG  V  A + QK++A+  AAR AL      ++A+S   + +     +D  E              +Q L+++  ++ W   S +  K+ GP
Sbjct: 1562 LERALKYEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLFFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTESSKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPM--HPVRELQERCQQQAEGLEYKASRSGNTATVEVFIDGVQVGVAQNPQKKMAQKLAARNALAALKEKEIAESKEKHINNGNAGEDQGENENGNKKNGHQPFTRQTLNDICLRKNWPMPSYRCVKEGGP 1858          
BLAST of DY262448 vs. ExPASy Swiss-Prot
Match: DCL1_ORYSJ (Endoribonuclease Dicer homolog 1 OS=Oryza sativa subsp. japonica GN=DCL1 PE=3 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 5.402e-41
Identity = 106/302 (35.10%), Postives = 166/302 (54.97%), Query Frame = 3
Query:  141 VENIINYNFKNKRLLEEALTHSSYTDS--TSYQRLEFIGDAALGLALSNYVFLAYPQLDPGQLSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFAEAVSQEDNTAVYG----GSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIVTLEELQQQPQPVTLLFKLCQKNGKQVDIKHWRKNRKNIASVYVDGSFVASASSEQKEIAKLNAAREALXKLAQSMPVNCDVCEIFDDIDEKFEIEA-AKQKLHELXRKEKWAQTSLQIEKDXGPHMIRNYVCSSNAPT 1025
            ++ ++   F+NK LL EA+TH+S   S  + YQRLEF+GDA L   ++ ++F  Y  L PG+L+ LRAA ++ E  ARVAVKH  +  +RH ++AL+ +++EF + V +E     +     G  KAPKVL DIVESIA AI++D  +D   +W +F+ LL P+VT E L     PV  L + CQ+  + ++ K  R        V+VDG  +  A + QK++A+  AAR AL  L +         E   D ++K   +   +Q L+++  + +W     +   + GP   + +V S    T
Sbjct: 1541 LKGVLGIEFQNKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLFFTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALETQIREFVKDVQEELLKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGYDTSVVWKVFQPLLHPMVTPETLPM--HPVRELQERCQQQAEGLEYKASRAGNIATVEVFVDGVQIGVAQNPQKKMAQKLAARNALVVLKEKETATKKEDE--RDGEKKNGAQMFTRQTLNDICLRRQWPMPQYRCVNEGGPAHAKRFVYSVRVNT 1838          
BLAST of DY262448 vs. ExPASy Swiss-Prot
Match: DCL3A_ORYSJ (Endoribonuclease Dicer homolog 3a OS=Oryza sativa subsp. japonica GN=DCL3A PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 3.510e-32
Identity = 101/278 (36.33%), Postives = 153/278 (55.04%), Query Frame = 3
Query:   78 LLKEAMLTSLPSPEMEDAVF-YVENIINYNFKNKRLLEEALTHSSYTDSTS---YQRLEFIGDAALGLALSNYVFLAYPQLDPGQLSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFA---EAVSQEDNTAVYGGSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIVTLEELQQQPQPVTLLFKLCQKNGKQVDIKHWRKNRKNIASVYV---DGSFVASASSEQKEIAKLNAAREALXKLAQS---MPVNCDVCEIFD 872
            +L  ++ T LP    +D VF  +E  + Y+F  K LL EALTH S  +  +   Y+RLEF+GDA L + L+ Y+F ++   + G+L+ LR+A+++ E  A+VAVKH F+ F++HS+  L D++ E+    E  S +    +  G  K PKVL DIVESIA AI +D   DL  +W IF  LL PIVT E L+    P   L + C K+G  V I    +    +A++ V   +   V    S++++ AK +A+   L  L +    +P N    E F+
Sbjct: 1226 ILSASVQTYLP----KDNVFEMLEAKLGYSFSVKGLLVEALTHPSQQELGAKYCYERLEFLGDAVLDILLTRYLFNSHKDTNEGELTDLRSASVNNENFAQVAVKHNFHHFLQHSSGLLLDQITEYVNRLEGSSMDKVELLSDGLPKGPKVLGDIVESIAGAILLDTKLDLDVVWGIFEPLLSPIVTPENLEL--PPYRELIEWCGKHGYFVGINCRDQGDTVVATLDVQLKEVLLVRQGFSKKRKDAKAHASSLLLKDLEEKGLIIPKNASKTEQFE 1497          
BLAST of DY262448 vs. ExPASy Swiss-Prot
Match: DCL3B_ORYSJ (Endoribonuclease Dicer homolog 3b OS=Oryza sativa subsp. japonica GN=DCL3B PE=2 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 4.744e-29
Identity = 85/266 (31.95%), Postives = 141/266 (53.01%), Query Frame = 3
Query:   69 DYRLLKEAMLTS--LPSPEMEDAVFYVENIINYNFKNKRLLEEALTHSSYTD---STSYQRLEFIGDAALGLALSNYVFLAYPQLDPGQLSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFAEA---VSQEDNTAVYGGSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIVTLEELQQQPQPVTLLFKLCQKNGKQVDIKHWRKNRKNIASVYV---DGSFVASASSEQKEIAKLNAAREALXKLAQ 833
            D +LL+E    +  L S    + +  +E  + YNF  K LL EA+TH S  +      YQRLEF+GD+ L L L+ +++  +  +DPG+L+ LR+A +S E  A+  V++  +  ++H +  L +++ E+  +      +++  +   + K PKVL DI+ESIA A+++D DF++  +W IF  LL P++T ++L     P   L +LC   G  ++ K   K  + I  + +   D   VA      K+ AK  AA   L  L Q
Sbjct: 1218 DMKLLQEVKFNASHLCSLSKINDIEELEAKLKYNFSVKGLLLEAITHPSLQELGVDYCYQRLEFLGDSVLDLLLTRHLYATHTDVDPGELTDLRSALVSNENFAQAVVRNNIHSHLQHGSGILLEQITEYVRSNLECQGKESEFLQHTTCKVPKVLGDIMESIAGAVFIDTDFNVDMVWEIFEPLLSPLITPDKLAL--PPYRELLELCSHIGCFLNSKCTSKGEEVIIEMSLQLRDELLVAQGHDRNKKRAKAKAASRILADLKQ 1481          
BLAST of DY262448 vs. ExPASy Swiss-Prot
Match: RTL1_ORYSJ (Ribonuclease 3-like protein 1 OS=Oryza sativa subsp. japonica GN=Os01g0551100 PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 8.091e-29
Identity = 89/232 (38.36%), Postives = 137/232 (59.05%), Query Frame = 3
Query:  159 YNFKN--KRLLEEALTHSSYTDSTS-----YQRLEFIGDAALGLALSNYVFLAYPQLDPGQLSLLRAANISTEKLARVAVKHGFYKFV-RHSAAALDDKVKEFAEAVSQEDNTAVYGGSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIVTLEELQQQPQPVTLLFKLCQKNGKQVDIK--HWRKNRKNIASVYVDGSFVASASS-----EQKEIAKLNAAR 809
            Y+F++    LLE+ALTHS +    +     +QRLEF+GDAALGLA +   +   P LD G L++LR+AN+ST+KLARVAV+   Y  + R++ A  D +V  F ++V    +    G  I+ P+VLADIVE+I  A+Y+D   DL+ L  + + L EPI+T + L + P+  ++L +L  ++ + ++IK   WRK    +A+V  DG   A  +S      + E+ KL   R
Sbjct:   31 YSFRDGGALLLEDALTHSVHPRDEAGGRARHQRLEFLGDAALGLAFATIFYRDDPGLDQGDLTVLRSANVSTQKLARVAVRRRLYPLLRRYNCAPQDHEVSRFTKSVEGPYS----GDPIEGPRVLADIVEAIVGAVYLDSKLDLEVLQKVAKLLCEPIITKKALLEDPE--SMLNELGGEHREDLEIKILAWRK----VANVVDDGREQAITTSGLGNGSEDEVGKLRTIR 252          
BLAST of DY262448 vs. ExPASy Swiss-Prot
Match: DCL2A_ORYSJ (Endoribonuclease Dicer homolog 2a OS=Oryza sativa subsp. japonica GN=DCL2A PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.075e-28
Identity = 83/239 (34.73%), Postives = 125/239 (52.30%), Query Frame = 3
Query:  141 VENIINYNFKNKRLLEEALTHSSYTDS---TSYQRLEFIGDAALGLALSNYVFLAYPQLDPGQLSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFAEAVSQEDNTAVYG--GSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIVTLEELQQQPQPVTLLFKLCQKNGKQVDIKHWRKNRKNIASVYV-----DGSFVASASSEQKEIAKLNAAREALXKL 827
            +E ++ Y F +  LL EALTH SY  S   + YQRLEF+GDA L    + Y +  YP   P  L+ LR+A+++    A  AVK G  K + HS++ L  K+  + E   Q      YG    I  PKVL D++ESIA AIY+D   D + +W   + LLEP+ T E +  +P PV  L + C +  +   I + + +   ++SV       + ++ A+ S   K +AK  A++  L  L
Sbjct: 1164 LEGMLGYKFNDSLLLLEALTHGSYQTSGPTSCYQRLEFLGDAILDHLFTEYYYSKYPDCTPELLTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYYLEEFGQSFTGPSYGWEAGIGLPKVLGDVIESIAGAIYLDSKCDKEVVWRSMKRLLEPLATPETI--EPDPVKGLQEFCDR--RSFKITYEKNHVDGVSSVIARVKAGETTYSATKSGPCKLVAKKLASKAVLKDL 1398          
BLAST of DY262448 vs. ExPASy Swiss-Prot
Match: DCL2B_ORYSJ (Endoribonuclease Dicer homolog 2b OS=Oryza sativa subsp. japonica GN=DCL2B PE=2 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 6.411e-26
Identity = 82/239 (34.31%), Postives = 123/239 (51.46%), Query Frame = 3
Query:  141 VENIINYNFKNKRLLEEALTHSSYTDS---TSYQRLEFIGDAALGLALSNYVFLAYPQLDPGQLSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFAEAVSQEDNTAVYG--GSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIVTLEELQQQPQPVTLLFKLCQKNGKQVDIKHWRKNRKN-----IASVYVDGSFVASASSEQKEIAKLNAAREALXKL 827
            +E ++ Y F +  LL EALTH SY  S   + YQRLEF+GDA L    + Y +  YP   P  L+ LR+A+++    A  AVK G  K + HS++ L  K+  +   + Q      YG    I  PKVL D++ESIA AIY+D   D + +W   + LLEP+ T E +  +P PV  L + C +   ++    + KN  +     IA V    +  ++  S   ++AK  A++  L  L
Sbjct: 1135 LEGMLGYKFNDSLLLLEALTHGSYQTSGPTSCYQRLEFLGDAILDHLFTEYYYSKYPDCTPELLTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYY---LGQSFTGPSYGWEAGIGLPKVLGDVIESIAGAIYLDSKCDKEVVWRSMKRLLEPLATPETI--EPDPVKGLQEFCDRRSFKIT---YEKNHVDGVSSVIARVKAGETTYSATKSGPCKLAKKLASKAVLKDL 1365          
BLAST of DY262448 vs. ExPASy Swiss-Prot
Match: DCL4_ORYSJ (Endoribonuclease Dicer homolog 4 OS=Oryza sativa subsp. japonica GN=DCL4 PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.579e-24
Identity = 73/239 (30.54%), Postives = 123/239 (51.46%), Query Frame = 3
Query:  141 VENIINYNFKNKRLLEEALTHSSYTDSTS--YQRLEFIGDAALGLALSNYVFLAYPQLDPGQLSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFAEAVSQEDNTAVYGGSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIVTLEELQQQPQPVTLLFKLCQKNG--------KQVDIKHWRKNRKNIASVYVDGSFVASASSEQKEIAKLNAAREALXKL 827
            +E +I Y FK+K LL +A  H S++  +   YQRLEF+GDA L   +++Y++  YP + PGQ++ LR+  +  + LA  AV+   +K +   +  L   + +F   V   ++          PK L DIVES   A+ +D  F+L  +W +   LL+P++T   +     P+  L +LCQ +G         + D ++  K   NI S  +    + +A++   + A+  AA+E L KL
Sbjct: 1217 LEELIGYKFKHKGLLLQAFVHPSFSQHSGGCYQRLEFLGDAVLEYVITSYLYSTYPDIKPGQITDLRSLAVGNDSLAYAAVEKSIHKHLIKDSNHLTSAISKFEMYVKLSNSEKDLLEEPACPKALGDIVESCIGAVLLDSGFNLNYVWKVMLMLLKPVLTFANM--HTNPMRELRELCQCHGFELGLPKPMKADGEYHVKVEVNIKSKII----ICTAANRNSKAARKFAAQETLSKL 1449          
The following BLAST results are available for this feature:
BLAST of DY262448 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 214
Match NameE-valueIdentityDescription
RTL2_ORYSJ2.327e-6851.38Ribonuclease 3-like protein 2 OS=Oryza sativa subs... [more]
RTL3_ORYSJ8.605e-4742.69Ribonuclease 3-like protein 3 OS=Oryza sativa subs... [more]
DICER_ARATH6.381e-4235.79Endoribonuclease Dicer homolog OS=Arabidopsis thal... [more]
DCL1_ORYSJ5.402e-4135.10Endoribonuclease Dicer homolog 1 OS=Oryza sativa s... [more]
DCL3A_ORYSJ3.510e-3236.33Endoribonuclease Dicer homolog 3a OS=Oryza sativa ... [more]
DCL3B_ORYSJ4.744e-2931.95Endoribonuclease Dicer homolog 3b OS=Oryza sativa ... [more]
RTL1_ORYSJ8.091e-2938.36Ribonuclease 3-like protein 1 OS=Oryza sativa subs... [more]
DCL2A_ORYSJ3.075e-2834.73Endoribonuclease Dicer homolog 2a OS=Oryza sativa ... [more]
DCL2B_ORYSJ6.411e-2634.31Endoribonuclease Dicer homolog 2b OS=Oryza sativa ... [more]
DCL4_ORYSJ1.579e-2430.54Endoribonuclease Dicer homolog 4 OS=Oryza sativa s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionIC0AAA100AA07RM1 CitNFL Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY262448 ID=DY262448|Name=DY262448|organism=Citrus clementina|type=EST|length=1334bp
CTGACTCATTGTTTCTCTCAAAAATAATGAACCCCGAGTCCTTCACGCTC
CCACGCGCCACCGTCACCGATTACCGGCTGCTGAAGGAGGCGATGCTAAC
CTCCCTCCCGTCTCCCGAGATGGAAGACGCAGTTTTCTACGTGGAGAACA
TCATCAACTACAACTTCAAAAACAAACGCCTCCTCGAAGAAGCCTTGACG
CACTCCTCGTACACCGATTCGACGTCGTATCAGCGGCTCGAGTTCATTGG
CGATGCCGCCTTGGGCTTGGCCTTGAGTAATTATGTGTTCTTGGCTTACC
CTCAGTTGGATCCTGGACAGCTGTCGCTTCTACGCGCCGCCAATATTAGT
ACCGAGAAATTAGCGCGCGTGGCCGTCAAGCACGGATTTTATAAGTTCGT
CAGACACAGTGCTGCTGCTCTTGATGATAAGGTTAAGGAATTTGCCGAAG
CAGTGAGCCAAGAAGATAATACGGCTGTGTATGGTGGATCAATAAAAGCA
CCAAAGGTTCTTGCCGATATTGTTGAATCCATAGCGGCTGCAATTTACGT
AGACATTGATTTTGATCTCCAAAAGCTCTGGATGATCTTTAGGGGTCTTT
TAGAGCCAATTGTAACCCTTGAAGAATTACAGCAACAGCCCCAACCAGTT
ACACTATTGTTTAAGTTATGTCAGAAAAATGGAAAGCAAGTTGATATCAA
GCACTGGAGAAAGAACAGAAAAAATATTGCCAGTGTATACGTGGACGGCA
GTTTTGTAGCCTCGGCTTCTTCTGAGCAGAAGGAAATTGCTAAGCTTAAT
GCTGCAAGGGAAGCTTTGGNAAAGTTAGCACAATCAATGCCAGTTAATTG
TGATGTCTGTGAAATTTTTGATGATATTGATGAGAAGTTTGAGATTGAAG
CAGCCAAACAGAAATTGCATGAACTCTGNCGAAAAGAGAAGTGGGCCCAA
ACCAGTTTACAGATTGAGAAAGATGANGGTCCTCACATGATAAGAAATTA
TGTCTGCAGTTCAAATGCACCTACAGATGGTGTGCTTTTTATCAGGGGAG
TGAAAAATCAAAAGTAAAGGAGCAAAAGATTTCGCGCCTTCATGAGGTTT
CCTGCCCTGCGGGAATCCCCTATCTTTGCCAAAAGGATGAAAGGGAAATA
AAACCCCCTATCCCCTGAAAGGAAATGGGCGTTGGGTCACCAAAAAACAC
CCGGGCCAGACCCGGGTCCCGAAAAAAAATTAAAAAATATTTTTTTTCCT
CCCTTTGGGTGGTTGGTGGTGGTCGCGGAGCGAAAGACCCAGAGAGAATC
CCCCCCGCGGATCGAGTATTTTGTGTTGTGTTTT
back to top