DY262452

Overview
NameDY262452
Unique NameDY262452
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1232
Libraries
Library NameType
CitNFLcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DY262452_ssr29 microsatellite DY262452_ssr29:29..56. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig2314 contig Ccv1_Contig2314:1..1232. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY262452 vs. ExPASy Swiss-Prot
Match: GH36_ARATH (Indole-3-acetic acid-amido synthetase GH3.6 OS=Arabidopsis thaliana GN=GH3.6 PE=1 SV=1)

HSP 1 Score: 462.611 bits (1189), Expect = 2.132e-129
Identity = 229/307 (74.59%), Postives = 257/307 (83.71%), Query Frame = 2
Query:  152 MPEAPKNSY--PSDYSLDEMNKKKLEFIENVTSNPDEVQKKVLSEILLRNAHVEYLQRNGLNGHTDRESFKKTMPVITYEDIQADINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIXXXXXXXXXXXXXXMPVMSQFIPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSCHFKERPYDPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPLVVKDIRTGTIDSQITDPSVRDAVMKILKTNPKLAGFNENECRKDCWQGIITRVWPNTK 1066
            MPEAPK +    SD SL E NK KL+FIE+VT+N D+VQ++VL EIL RNA VEYL+R+GL G TDRE+FK  MPV+TYEDIQ +INRIANGD S +LCS PISEFLTSSGTSGGERKLMPTI              MPVM QF+PGLDKGKGMYFLFIKSE+KTPGGL ARPVLTSYYKS HFK RPYDPYTNYTSPN+TILC DSYQSMYSQ+LCGLCQ+KEVLRVGAVFASGFIRAI+FLEKHWP + +DIRTGT+ S+ITD SVR+AV +ILK +PKLA F E+ECRK  WQGIITR+WPNTK
Sbjct:    1 MPEAPKIAALEVSDESLAEKNKNKLQFIEDVTTNADDVQRRVLEEILSRNADVEYLKRHGLEGRTDRETFKHIMPVVTYEDIQPEINRIANGDKSQVLCSNPISEFLTSSGTSGGERKLMPTIEEELDRRSLLYSLLMPVMDQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKNRPYDPYTNYTSPNQTILCSDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWPELARDIRTGTLSSEITDSSVREAVGEILKPDPKLADFVESECRKTSWQGIITRLWPNTK 307          
BLAST of DY262452 vs. ExPASy Swiss-Prot
Match: GH35_ARATH (Indole-3-acetic acid-amido synthetase GH3.5 OS=Arabidopsis thaliana GN=GH3.5 PE=1 SV=1)

HSP 1 Score: 459.914 bits (1182), Expect = 1.382e-128
Identity = 229/307 (74.59%), Postives = 256/307 (83.39%), Query Frame = 2
Query:  152 MPEAPKNSYPS--DYSLDEMNKKKLEFIENVTSNPDEVQKKVLSEILLRNAHVEYLQRNGLNGHTDRESFKKTMPVITYEDIQADINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIXXXXXXXXXXXXXXMPVMSQFIPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSCHFKERPYDPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPLVVKDIRTGTIDSQITDPSVRDAVMKILKTNPKLAGFNENECRKDCWQGIITRVWPNTK 1066
            MPEAPK       D +LD+ NK+KL+ IE +TSN D+VQ++VL EIL RNA VEYL+R+ LNG TDRE+FK  MPVITYEDI+ +INRIANGD SPIL SKPISEFLTSSGTSGGERKLMPTI              MPVMSQF+PGL+ GKGMYFLFIKSE+KTPGGL ARPVLTSYYKS HFKERPYDPYTNYTSPNETILC DSYQSMYSQ+LCGLCQ++EVLRVGAVFASGFIRAI+FLEKHW  +V+DIRTGT+ S ITDPSVR+AV KILK +PKLA F E EC+K  WQGIITR+WPNTK
Sbjct:    1 MPEAPKKESLEVFDLTLDQKNKQKLQLIEELTSNADQVQRQVLEEILTRNADVEYLRRHDLNGRTDRETFKNIMPVITYEDIEPEINRIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDRRSLLYSLLMPVMSQFVPGLENGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPYDPYTNYTSPNETILCSDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKHWIELVRDIRTGTLSSLITDPSVREAVAKILKPSPKLADFVEFECKKSSWQGIITRLWPNTK 307          
BLAST of DY262452 vs. ExPASy Swiss-Prot
Match: GH31_ARATH (Probable indole-3-acetic acid-amido synthetase GH3.1 OS=Arabidopsis thaliana GN=GH3.1 PE=2 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 1.303e-102
Identity = 184/289 (63.67%), Postives = 215/289 (74.39%), Query Frame = 2
Query:  200 EMNKKKLEFIENVTSNPDEVQKKVLSEILLRNAHVEYLQRNGLNGHTDRESFKKTMPVITYEDIQADINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIXXXXXXXXXXXXXXMPVMSQFIPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSCHFKERPYDPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPLVVKDIRTGTIDSQITDPSVRDAVMKILKTNPKLAGFNENECRKDCWQGIITRVWPNTK 1066
            E + K L FIE +T N D VQ+ +L+EIL RNA  EYL+R  L G TDR++FK  +PVITYED+Q +I RIA+GD SPIL + PISEFLTSSGTS GERKLMPTI              MPVM+ ++PGLDKGKGMYFLF+KSE KTPGGL ARPVLTSYYKS HF+ RPYDPY  YTSPNE ILCPDS+QSMY+Q+LCGL     VLRVGAVFASG +RAIRFL+ HW     DI  G +DS+ITDPS+R  +  ILK +P LA F   EC+ D W+ IITR+WPNTK
Sbjct:   17 EKDAKALRFIEEMTRNADTVQENLLAEILARNADTEYLRRFNLCGATDRDTFKTKIPVITYEDLQPEIQRIADGDRSPILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLMPVMNLYVPGLDKGKGMYFLFVKSETKTPGGLPARPVLTSYYKSEHFRSRPYDPYNVYTSPNEAILCPDSFQSMYTQMLCGLLDRLSVLRVGAVFASGLLRAIRFLQLHWSRFAHDIELGCLDSEITDPSIRQCMSGILKPDPVLAEFIRRECKSDNWEKIITRIWPNTK 305          
BLAST of DY262452 vs. ExPASy Swiss-Prot
Match: GH32_ORYSJ (Probable indole-3-acetic acid-amido synthetase GH3.2 OS=Oryza sativa subsp. japonica GN=GH3.2 PE=2 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 1.592e-100
Identity = 180/290 (62.07%), Postives = 221/290 (76.21%), Query Frame = 2
Query:  200 EMNKKKLEFIENVTSNPDEVQKKVLSEILLRNAHVEYLQRNGLNGHTDRESFKKTMPVITYEDIQADINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIXXXXXXXXXXXXXXMPVMSQFIPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSCHFKERPYDPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPLVVKDIRTGTIDSQITDPSVRDAVMKILKT-NPKLAGFNENECRKDCWQGIITRVWPNTK 1066
            E + +KLEFIE +T   D VQ++VL+ IL RN   EYL+R+G+ G TDRE+FK  +PV+TYED++ +I RIANGD S I+ S PI+EFLTSSGTS GERKLMPTI              MPVM+ ++PGLDKGKG+YFLFIKSE KTPGGL ARPVLTSYYKS HFK RP+DPY  YTSP   ILC D++QSMY+Q+LCGL    EVLRVGAVFASG +RAIRFL+ HW  +  DIRTGT+ +++T+PS+RDAV ++L   + +LA F E EC KD W+GIITR+WPNTK
Sbjct:   27 ERDAEKLEFIEEMTRGFDAVQERVLAAILARNNGAEYLRRHGMEGRTDREAFKARVPVVTYEDLRPEIERIANGDRSNIISSHPITEFLTSSGTSAGERKLMPTIEDELDRRQMLYSLLMPVMNLYVPGLDKGKGLYFLFIKSETKTPGGLPARPVLTSYYKSDHFKHRPFDPYNVYTSPTAAILCTDAFQSMYAQMLCGLVARAEVLRVGAVFASGLLRAIRFLQLHWRELAHDIRTGTLSAKVTEPSIRDAVAEVLAAPDAELAAFVEAECGKDKWEGIITRMWPNTK 316          
BLAST of DY262452 vs. ExPASy Swiss-Prot
Match: GH38_ORYSJ (Probable indole-3-acetic acid-amido synthetase GH3.8 OS=Oryza sativa subsp. japonica GN=GH3.8 PE=2 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 1.348e-99
Identity = 177/296 (59.80%), Postives = 221/296 (74.66%), Query Frame = 2
Query:  179 PSDYSLDEMNKKKLEFIENVTSNPDEVQKKVLSEILLRNAHVEYLQRNGLNGHTDRESFKKTMPVITYEDIQADINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIXXXXXXXXXXXXXXMPVMSQFIPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSCHFKERPYDPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPLVVKDIRTGTIDSQITDPSVRDAVMKILKTNPKLAGFNENECRKDCWQGIITRVWPNTK 1066
            P+  ++ E + +KL FI+ +T+N D VQ++VL EIL RNA  EYL + GL+G TDR +F+  +PV++Y+D+Q  I RIANGD SPIL + P+SEFLTSSGTS GERKLMPTI              MPVM+ ++PGLDKGKG+YFLF+KSE KTPGGL ARPVLTSYYKS HFK RPYDPY NYTSP   ILC D++QSMY+Q++CGLCQ  +VLR+GAVFASG +RAIRFL+ +W  +  DI +G +  ++TDPSVR+AV  IL  +P+LA     EC K  W GIITRVWPNTK
Sbjct:   17 PAAGAVKEGDVEKLRFIDEMTTNVDAVQERVLGEILGRNAGTEYLTKCGLDGATDRAAFRAKVPVVSYDDLQPYIQRIANGDRSPILSTHPVSEFLTSSGTSAGERKLMPTIMDELDRRQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKSETKTPGGLTARPVLTSYYKSDHFKNRPYDPYHNYTSPTAAILCADAFQSMYAQMVCGLCQRNDVLRLGAVFASGLLRAIRFLQLNWEQLADDIESGELTPRVTDPSVREAVAAILLPDPELAKLIRAECSKGDWAGIITRVWPNTK 312          
BLAST of DY262452 vs. ExPASy Swiss-Prot
Match: GH38_ORYSI (Probable indole-3-acetic acid-amido synthetase GH3.8 OS=Oryza sativa subsp. indica GN=GH3.8 PE=2 SV=2)

HSP 1 Score: 363.614 bits (932), Expect = 1.348e-99
Identity = 177/296 (59.80%), Postives = 221/296 (74.66%), Query Frame = 2
Query:  179 PSDYSLDEMNKKKLEFIENVTSNPDEVQKKVLSEILLRNAHVEYLQRNGLNGHTDRESFKKTMPVITYEDIQADINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIXXXXXXXXXXXXXXMPVMSQFIPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSCHFKERPYDPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPLVVKDIRTGTIDSQITDPSVRDAVMKILKTNPKLAGFNENECRKDCWQGIITRVWPNTK 1066
            P+  ++ E + +KL FI+ +T+N D VQ++VL EIL RNA  EYL + GL+G TDR +F+  +PV++Y+D+Q  I RIANGD SPIL + P+SEFLTSSGTS GERKLMPTI              MPVM+ ++PGLDKGKG+YFLF+KSE KTPGGL ARPVLTSYYKS HFK RPYDPY NYTSP   ILC D++QSMY+Q++CGLCQ  +VLR+GAVFASG +RAIRFL+ +W  +  DI +G +  ++TDPSVR+AV  IL  +P+LA     EC K  W GIITRVWPNTK
Sbjct:   17 PAAGAVKEGDVEKLRFIDEMTTNVDAVQERVLGEILGRNAGTEYLTKCGLDGATDRAAFRAKVPVVSYDDLQPYIQRIANGDRSPILSTHPVSEFLTSSGTSAGERKLMPTIMDELDRRQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKSETKTPGGLTARPVLTSYYKSDHFKNRPYDPYHNYTSPTAAILCADAFQSMYAQMVCGLCQRNDVLRLGAVFASGLLRAIRFLQLNWEQLADDIESGELTPRVTDPSVREAVAAILLPDPELAKLIRAECSKGDWAGIITRVWPNTK 312          
BLAST of DY262452 vs. ExPASy Swiss-Prot
Match: GH31_ORYSJ (Probable indole-3-acetic acid-amido synthetase GH3.1 OS=Oryza sativa subsp. japonica GN=GH3.1 PE=2 SV=1)

HSP 1 Score: 360.147 bits (923), Expect = 1.490e-98
Identity = 183/307 (59.61%), Postives = 224/307 (72.96%), Query Frame = 2
Query:  152 MPEAPKNSYPSDYSLDE-MNKKKLEFIENVTSNPDEVQKKVLSEILLRNAHVEYLQRNGLNGHTDR-ESFKKTMPVITYEDIQADINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIXXXXXXXXXXXXXXMPVMSQFIPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSCHFKERPYDPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPLVVKDIRTGTIDSQITDPSVRDAVMKILKTNPKLAGFNENECRKDCWQGIITRVWPNTK 1066
            MPEAP       Y      + + LEFIE+VT+N  +VQ++VL EIL +NA  EYL+R G+ G  D  ++F++ +P++TYE +Q DI RIANGDTSPI   KPISEFLTSSGTSGGERKLMPTI              MPVMSQ + GLDKGK MY LF+K+E++TPGGL ARPVLTSYY+S  F +RP DPYT+YTSP+E ILC DSYQSMY+QLLCGL    +VLRVGAVFASGF+RAI FLEKHW  +  DIRTG +D +ITD  VRDAV ++L+ +P LA   E+EC +  W+GII R+WP TK
Sbjct:    1 MPEAPTAKTAPAYGYAPGAHAEALEFIEHVTANAGQVQRRVLGEILAQNAPAEYLRRYGIPGSPDVVDAFRRLVPLVTYEGLQPDILRIANGDTSPIFSGKPISEFLTSSGTSGGERKLMPTIADEMNRRSLLYSLLMPVMSQSVSGLDKGKAMYLLFVKAESRTPGGLAARPVLTSYYRSRQFLDRPRDPYTSYTSPDEAILCVDSYQSMYAQLLCGLVHRADVLRVGAVFASGFLRAIHFLEKHWARLCHDIRTGELDPEITDRVVRDAVGRVLRADPALADAIEDECARASWEGIIRRLWPRTK 307          
BLAST of DY262452 vs. ExPASy Swiss-Prot
Match: GH32_ARATH (Indole-3-acetic acid-amido synthetase GH3.2 OS=Arabidopsis thaliana GN=GH3.2 PE=1 SV=2)

HSP 1 Score: 358.607 bits (919), Expect = 4.336e-98
Identity = 177/304 (58.22%), Postives = 225/304 (74.01%), Query Frame = 2
Query:  158 EAPKNSYPSDYSLDEMNKKKLEFIENVTSNPDEVQKKVLSEILLRNAHVEYLQRNGLNGHTDRESFKKTMPVITYEDIQADINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIXXXXXXXXXXXXXXMPVMSQFIPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSCHFKERPYDPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPLVVKDIRTGTIDSQITDPSVRDAVMKIL-KTNPKLAGFNENECRKDCWQGIITRVWPNTK 1066
            ++P  S     +  E + K L+FIE +T NPD VQ+KVL EIL RN++ EYL+R  L+G  DR++FK  +PV+TYED++ +I RI+NGD SPIL S PI+EFLTSSGTS GERKLMPTI              MPVM+ ++PGLDKGKG+YFLF+KSE+KT GGL ARPVLTSYYKS HFK RPYDPY  YTSPNE ILC DS QSMY+Q+LCGL    EVLR+GAVFASG +RAI FL+ +W  + +DI TGT+ S+I DP++++ + KIL K + +LA F    C ++ W+GIIT++WPNTK
Sbjct:    4 DSPLQSRMVSATTSEKDVKALKFIEEMTRNPDSVQEKVLGEILTRNSNTEYLKRFDLDGVVDRKTFKSKVPVVTYEDLKPEIQRISNGDCSPILSSHPITEFLTSSGTSAGERKLMPTIEEDLDRRQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKSESKTSGGLPARPVLTSYYKSDHFKRRPYDPYNVYTSPNEAILCSDSSQSMYAQMLCGLLMRHEVLRLGAVFASGLLRAISFLQNNWKELARDISTGTLSSRIFDPAIKNRMSKILTKPDQELAEFLVGVCSQENWEGIITKIWPNTK 307          
BLAST of DY262452 vs. ExPASy Swiss-Prot
Match: GH34_ORYSJ (Probable indole-3-acetic acid-amido synthetase GH3.4 OS=Oryza sativa subsp. japonica GN=GH3.4 PE=2 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 4.059e-96
Identity = 175/290 (60.34%), Postives = 217/290 (74.83%), Query Frame = 2
Query:  206 NKKKLEFIENVTSNPDEVQKKVLSEILLRNAHVEYLQRNGLNGHTDR--ESFKKTMPVITYEDIQADINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIXXXXXXXXXXXXXXMPVMSQFIPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSCHFKERPYDPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPLVVKDIRTGTIDSQITDPSVRDAVMKILK-TNPKLAGFNENECRKDCWQGIITRVWPNTK 1066
            +++KLE IE VT N  + Q++VL EIL +NA  EYL+R G+ G      E+F++  P++TYEDI  D+ RIANGDTSPIL  KP+SEFLTSSGTSGGERKLMPTI              MPVMS+ +PGLDKGK MY  F+KSE +TPGGL ARPVLTS+Y+S +F ERP+DPYT YTSP+E +LC D+YQSMY+QL+CGL    +VLRVGAVFASGF+RAIRFLEKHWP + +DIR G +D  +TDP+VR AV ++L+  +P LA   E EC +  WQGII RVWP+TK
Sbjct:   23 HREKLEHIERVTRNAGQEQRRVLEEILAQNAQAEYLRRLGVPGDAPGADEAFRRLAPLVTYEDILPDVLRIANGDTSPILSGKPVSEFLTSSGTSGGERKLMPTIEEEMERRSGLYSLLMPVMSRQVPGLDKGKAMYLYFVKSEWRTPGGLPARPVLTSFYRSRYFLERPHDPYTVYTSPDEAVLCEDAYQSMYAQLICGLVHRADVLRVGAVFASGFLRAIRFLEKHWPSLCRDIRAGELDGGVTDPAVRGAVGRVLRGADPALADAIEAECARPSWQGIIRRVWPSTK 312          
BLAST of DY262452 vs. ExPASy Swiss-Prot
Match: GH33_ARATH (Indole-3-acetic acid-amido synthetase GH3.3 OS=Arabidopsis thaliana GN=GH3.3 PE=1 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 8.463e-94
Identity = 174/298 (58.39%), Postives = 219/298 (73.49%), Query Frame = 2
Query:  179 PSDYSLDEMNKKKLEFIENVTSNPDEVQKKVLSEILLRNAHVEYLQRNGLNGHTDRESFKKTMPVITYEDIQADINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIXXXXXXXXXXXXXXMPVMSQFIPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSCHFKERPYDPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPLVVKDIRTGTIDSQITDPSVRDAVMKIL-KTNPKLAGFNENECRKD-CWQGIITRVWPNTK 1066
            P  +S    + K L FIE +T N D VQKKV+ EIL RN+  EYL+R GL G TDR++FK  +PV+ Y+D++ +I RIANGD S IL S PI+EFLTSSGTS GERKLMPTI              MPVM+ ++PGLDKGK +YFLF+K+E+KTPGGL ARPVLTSYYKS  FK RP DPY  YTSPNE ILCPDS QSMY+Q+LCGL    EVLR+GAVFASG +RAI FL+ +W  +  DI TGT+ S+I+DP++++++ KIL K + +LA F  + C +D  W+GIIT++WPNTK
Sbjct:   10 PMMHSPSTKDVKALRFIEEMTRNVDFVQKKVIREILSRNSDTEYLKRFGLKGFTDRKTFKTKVPVVIYDDLKPEIQRIANGDRSMILSSYPITEFLTSSGTSAGERKLMPTIDEDMDRRQLLYSLLMPVMNLYVPGLDKGKALYFLFVKTESKTPGGLPARPVLTSYYKSEQFKRRPNDPYNVYTSPNEAILCPDSSQSMYTQMLCGLLMRHEVLRLGAVFASGLLRAIGFLQTNWKELADDISTGTLSSRISDPAIKESMSKILTKPDQELADFITSVCGQDNSWEGIITKIWPNTK 307          
The following BLAST results are available for this feature:
BLAST of DY262452 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
GH36_ARATH2.132e-12974.59Indole-3-acetic acid-amido synthetase GH3.6 OS=Ara... [more]
GH35_ARATH1.382e-12874.59Indole-3-acetic acid-amido synthetase GH3.5 OS=Ara... [more]
GH31_ARATH1.303e-10263.67Probable indole-3-acetic acid-amido synthetase GH3... [more]
GH32_ORYSJ1.592e-10062.07Probable indole-3-acetic acid-amido synthetase GH3... [more]
GH38_ORYSJ1.348e-9959.80Probable indole-3-acetic acid-amido synthetase GH3... [more]
GH38_ORYSI1.348e-9959.80Probable indole-3-acetic acid-amido synthetase GH3... [more]
GH31_ORYSJ1.490e-9859.61Probable indole-3-acetic acid-amido synthetase GH3... [more]
GH32_ARATH4.336e-9858.22Indole-3-acetic acid-amido synthetase GH3.2 OS=Ara... [more]
GH34_ORYSJ4.059e-9660.34Probable indole-3-acetic acid-amido synthetase GH3... [more]
GH33_ARATH8.463e-9458.39Indole-3-acetic acid-amido synthetase GH3.3 OS=Ara... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionIC0AAA100AA12RM1 CitNFL Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY262452 ID=DY262452|Name=DY262452|organism=Citrus clementina|type=EST|length=1232bp
CACAAGCCTCTCTCTTTAGTCCCATTTATCTCTCTCTCTCTCTCTCTCTC
TCTCTCACAGACACACATACACACAAAAGAACACTCAAAATAAAACTCTT
TGAAGTTTATTAATTTTATCTCTTTCATACAAAACTGCCAAAGCCACCAC
CATGCCTGAAGCACCAAAGAACTCATACCCTAGTGATTATAGTCTTGATG
AGATGAACAAGAAGAAACTTGAGTTCATTGAAAATGTTACTTCAAACCCT
GATGAGGTTCAAAAGAAGGTTCTTTCAGAGATCCTCTTACGCAATGCTCA
TGTTGAGTACCTGCAAAGAAATGGCCTTAATGGCCACACCGATAGAGAGT
CTTTCAAAAAAACCATGCCTGTCATCACTTATGAAGATATCCAAGCTGAT
ATCAACCGTATTGCCAATGGAGATACTTCTCCTATCCTCTGCTCCAAGCC
CATTTCTGAGTTCTTGACTAGCTCTGGGACATCAGGTGGTGAACGAAAGT
TGATGCCAACAATTGAAGAAGAATTGGAGAGGAGGTCGCTGCTGTACAGC
CTATTGATGCCTGTGATGAGCCAGTTTATTCCTGGTCTAGACAAAGGCAA
AGGAATGTACTTTCTGTTCATAAAATCTGAGGCCAAGACTCCTGGTGGCC
TAGTGGCTCGCCCAGTCTTAACTAGCTATTACAAGAGCTGTCATTTCAAA
GAGAGGCCTTATGACCCATATACAAACTACACTAGCCCAAATGAAACCAT
TTTGTGCCCTGATTCTTACCAAAGCATGTACTCTCAATTGCTTTGTGGCC
TTTGCCAAAACAAAGAAGTCCTCAGGGTTGGTGCCGTTTTTGCCTCTGGT
TTCATTAGAGCTATTAGGTTTCTTGAGAAACATTGGCCTCTTGTCGTTAA
AGATATTAGAACTGGCACCATTGACTCCCAAATTACTGACCCATCTGTTA
GGGATGCTGTCATGAAGATCCTTAAAACAAACCCAAAACTTGCTGGTTTT
AATGAAAATGAATGCCGAAAAGACTGCTGGCAAGGGATCATAACAAGGGT
ATGGCCCAACACTAAATTATGTGGATGTTATTTGGGACGGGGAACCTGTT
AAAAATAAAACCCAAACCCTTGGATAACAAAACCAATGGCCCTCCCCCCT
TTGTTTGAACCCAGGGATGCGCTTTTCCTAGGGGGCCCACTTTGGGGGGG
CACACCCCTAACCCCCCCCCAAGCAAAAACCC
back to top