DY262454

Overview
NameDY262454
Unique NameDY262454
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length772
Libraries
Library NameType
CitNFLcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15105 contig Ccv1_Contig15105:13..784. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY262454 vs. ExPASy Swiss-Prot
Match: METK3_PETHY (S-adenosylmethionine synthetase 3 OS=Petunia hybrida GN=SAM3 PE=2 SV=1)

HSP 1 Score: 465.307 bits (1196), Expect = 1.640e-130
Identity = 222/231 (96.10%), Postives = 230/231 (99.57%), Query Frame = 3
Query:   78 METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGEITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH 770
            METFLFTSESVNEGHPDKLCDQISDA+LDACLEQDP+SKVACETCTKTNLVMVFGEITTKANV+YEKIVRDTCRNIGF+SDDVGLDADNCKVLVYIEQQSPDIAQGVHGHL+K+PEEIGAGDQGHMFGYATDETPEFMPLSHVLAT+LGA+LTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIA DLKEHVIKPVIPEKYLDEKTIFH
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNLVMVFGEITTKANVDYEKIVRDTCRNIGFISDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLTKQPEEIGAGDQGHMFGYATDETPEFMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAHDLKEHVIKPVIPEKYLDEKTIFH 231          
BLAST of DY262454 vs. ExPASy Swiss-Prot
Match: METK_MESCR (S-adenosylmethionine synthetase OS=Mesembryanthemum crystallinum GN=METK PE=2 SV=1)

HSP 1 Score: 459.144 bits (1180), Expect = 1.175e-128
Identity = 220/231 (95.24%), Postives = 227/231 (98.27%), Query Frame = 3
Query:   78 METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGEITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH 770
            M+TFLFTSESVNEGHPDKLCDQISDA+LDACL QD +SKVACETCTKTNLVMVFGEITTKANV+YEKI RDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHL+KRPEEIGAGDQGHMFGYATDETPE MPLSHVLAT+LGA+LTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH
Sbjct:    1 MDTFLFTSESVNEGHPDKLCDQISDAVLDACLAQDAESKVACETCTKTNLVMVFGEITTKANVDYEKIARDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH 231          
BLAST of DY262454 vs. ExPASy Swiss-Prot
Match: METK1_CATRO (S-adenosylmethionine synthetase 1 OS=Catharanthus roseus GN=SAMS1 PE=1 SV=1)

HSP 1 Score: 459.144 bits (1180), Expect = 1.175e-128
Identity = 219/231 (94.81%), Postives = 229/231 (99.13%), Query Frame = 3
Query:   78 METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGEITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH 770
            METFLFTSESVNEGHPDKLCDQISDA+LDACLEQDPDSKVACETCTKTN+VMVFGEITTKA V+YEKIVRDTCR+IGFVSDDVGLDADNCKVLV IEQQSPDIAQGVHGHL+KRPEEIGAGDQGHMFGYATDETPEFMPLSHVLAT+LGA+LTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTV+ISTQHDETVTND+IAADLKEHVIKPVIPEKYLDE+TIFH
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVVISTQHDETVTNDQIAADLKEHVIKPVIPEKYLDERTIFH 231          
BLAST of DY262454 vs. ExPASy Swiss-Prot
Match: METK2_PEA (S-adenosylmethionine synthetase 2 OS=Pisum sativum GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 457.603 bits (1176), Expect = 3.419e-128
Identity = 218/230 (94.78%), Postives = 227/230 (98.70%), Query Frame = 3
Query:   81 ETFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGEITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH 770
            ETFLFTSESVNEGHPDKLCDQISDA+LDACLEQDP+SKVACETCTKTN+VMVFGEITTKANV+YEKIVRDTCRNIGFVSDDVGLDADNCKVLV IEQQSPDIAQGVHGHL+KRPE+IGAGDQGHMFGYATDETPEFMPLSHVLAT+LGA LTEVRKNGTCPWLRPDGKTQVTVEYYN+ GAMVP+RVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH
Sbjct:    4 ETFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEFMPLSHVLATKLGASLTEVRKNGTCPWLRPDGKTQVTVEYYNDKGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH 233          
BLAST of DY262454 vs. ExPASy Swiss-Prot
Match: METK1_ELAUM (S-adenosylmethionine synthetase 1 OS=Elaeagnus umbellata GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 457.218 bits (1175), Expect = 4.465e-128
Identity = 219/231 (94.81%), Postives = 227/231 (98.27%), Query Frame = 3
Query:   78 METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGEITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH 770
            METFLFTSESVNEGHPDKLCDQISDA+LDACL QDPDSKVACETC+KTN+VMVFGEITTKANV+YEKIVRDTCR IGFVSDDVGLDADNCKVLV IEQQSPDIAQGVHGH +KRPEEIGAGDQGHMFGYATDETPE+MPLSHVLAT+LGA+LTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRAIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH 231          
BLAST of DY262454 vs. ExPASy Swiss-Prot
Match: METK1_POPTR (S-adenosylmethionine synthetase 1 OS=Populus trichocarpa GN=METK1 PE=2 SV=1)

HSP 1 Score: 456.062 bits (1172), Expect = 9.948e-128
Identity = 216/231 (93.51%), Postives = 226/231 (97.84%), Query Frame = 3
Query:   78 METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGEITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH 770
            METFLFTSESVNEGHPDKLCDQISDA+LDACLEQDPDSKVACETCTKTN+VMVFGEITTK  ++YEKIVRDTCRNIGF+SDDVGLDAD CKVLV IEQQSPDIAQGVHGH +KRPEEIGAGDQGHMFGYATDETPE+MPLSHVLAT+LGA+LTEVRKNGTCPWLRPDGKTQVTVEYYN+NGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKGKIDYEKIVRDTCRNIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH 231          
BLAST of DY262454 vs. ExPASy Swiss-Prot
Match: METK1_SOLTU (S-adenosylmethionine synthetase 1 OS=Solanum tuberosum GN=METK1 PE=2 SV=1)

HSP 1 Score: 455.292 bits (1170), Expect = 1.697e-127
Identity = 217/231 (93.94%), Postives = 227/231 (98.27%), Query Frame = 3
Query:   78 METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGEITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH 770
            METFLFTSESVNEGHPDKLCDQISDA+LDACLEQDP+SKVACETCTKTNLVMVFGEITTKA V+YEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHL+KRPEEIGAGDQGHMFGYATDETPE MPLSHVLAT+LGA+LTEVRKNGTCPWLRPDGKTQVTVEY N+NGAM+P++VHTVLISTQHDETVTNDEIA DLKEHVIKPVIPEKYLDEKTIFH
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNLVMVFGEITTKAIVDYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYCNDNGAMIPIKVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIFH 231          
BLAST of DY262454 vs. ExPASy Swiss-Prot
Match: METK_CARPA (S-adenosylmethionine synthetase OS=Carica papaya GN=SAMS PE=2 SV=1)

HSP 1 Score: 454.521 bits (1168), Expect = 2.894e-127
Identity = 218/231 (94.37%), Postives = 226/231 (97.84%), Query Frame = 3
Query:   78 METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGEITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH 770
            METFLFTSESVNEGHPDKLCDQISDA+LDACL QDPDSKVACETCTKTN+VMVFGEITTKA+V+YEKIVRDTCR+IGFVSDDVGLDAD CKVLV IEQQSPDIAQGVHGH +KRPEEIGAGDQGHMFGYATDETPEFMPLSHVLAT+LGA+LTEVRKNGTCPWLRPDGKTQVTVEYYNENGA VPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGARVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH 231          
BLAST of DY262454 vs. ExPASy Swiss-Prot
Match: METK1_ATRNU (S-adenosylmethionine synthetase 1 OS=Atriplex nummularia GN=SAMS1 PE=1 SV=2)

HSP 1 Score: 454.521 bits (1168), Expect = 2.894e-127
Identity = 217/231 (93.94%), Postives = 227/231 (98.27%), Query Frame = 3
Query:   78 METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGEITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH 770
            ++TFLFTSESVNEGHPDKLCDQISDA+LDACL QDP+SKVACETCTKTNLVMVFGEITTKANV+YEKIVR TCR+IGFVS DVGLDADNCKVLVYIEQQSPDIAQGVHGHLS+RPEEIGAGDQGHMFGYATDETPE MPLSHVLAT+LGA+LTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVP+RVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH
Sbjct:    5 VDTFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNLVMVFGEITTKANVDYEKIVRQTCRDIGFVSADVGLDADNCKVLVYIEQQSPDIAQGVHGHLSRRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH 235          
BLAST of DY262454 vs. ExPASy Swiss-Prot
Match: METK4_ATRNU (S-adenosylmethionine synthetase 4 OS=Atriplex nummularia GN=SAMS4 PE=1 SV=1)

HSP 1 Score: 453.366 bits (1165), Expect = 6.448e-127
Identity = 216/231 (93.51%), Postives = 227/231 (98.27%), Query Frame = 3
Query:   78 METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGEITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH 770
            ++TFLFTSESVNEGHPDKLCDQISDA+LDACL QDP+SKVACETCTKTNLVMVFGEITTKANV+YEKIVR TCR+IGFVS DVGLDADNCKVLVYIEQQSPDIAQGVHGHL++RPEEIGAGDQGHMFGYATDETPE MPLSHVLAT+LGA+LTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVP+RVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH
Sbjct:    5 VDTFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNLVMVFGEITTKANVDYEKIVRQTCRDIGFVSADVGLDADNCKVLVYIEQQSPDIAQGVHGHLTRRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFH 235          
The following BLAST results are available for this feature:
BLAST of DY262454 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK3_PETHY1.640e-13096.10S-adenosylmethionine synthetase 3 OS=Petunia hybri... [more]
METK_MESCR1.175e-12895.24S-adenosylmethionine synthetase OS=Mesembryanthemu... [more]
METK1_CATRO1.175e-12894.81S-adenosylmethionine synthetase 1 OS=Catharanthus ... [more]
METK2_PEA3.419e-12894.78S-adenosylmethionine synthetase 2 OS=Pisum sativum... [more]
METK1_ELAUM4.465e-12894.81S-adenosylmethionine synthetase 1 OS=Elaeagnus umb... [more]
METK1_POPTR9.948e-12893.51S-adenosylmethionine synthetase 1 OS=Populus trich... [more]
METK1_SOLTU1.697e-12793.94S-adenosylmethionine synthetase 1 OS=Solanum tuber... [more]
METK_CARPA2.894e-12794.37S-adenosylmethionine synthetase OS=Carica papaya G... [more]
METK1_ATRNU2.894e-12793.94S-adenosylmethionine synthetase 1 OS=Atriplex numm... [more]
METK4_ATRNU6.448e-12793.51S-adenosylmethionine synthetase 4 OS=Atriplex numm... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionIC0AAA100AB02RM1 CitNFL Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY262454 ID=DY262454|Name=DY262454|organism=Citrus clementina|type=EST|length=772bp
CCCCTCTATTTCTTCTTTCTCTGGTCAGCTTTCTCTCAATTCTAGATCTA
CCCGGTTCGCAGTTTTTGAAGAAAAATATGGAGACTTTTTTGTTCACTTC
AGAATCTGTGAACGAGGGTCATCCAGACAAGCTCTGTGATCAGATCTCCG
ATGCCATTCTCGATGCTTGTCTCGAACAAGACCCAGATAGCAAGGTGGCT
TGTGAAACCTGTACCAAGACTAACTTGGTTATGGTTTTTGGAGAGATCAC
AACCAAAGCTAATGTTAATTACGAGAAAATTGTTCGTGACACTTGCCGCA
ACATTGGATTTGTCTCTGATGATGTGGGTTTGGATGCTGATAACTGTAAG
GTTTTGGTTTACATTGAGCAACAAAGCCCTGATATCGCCCAGGGCGTTCA
TGGTCATTTGTCTAAACGCCCCGAGGAAATCGGTGCTGGTGATCAGGGGC
ATATGTTTGGTTATGCTACCGATGAGACTCCTGAATTTATGCCTCTGAGT
CATGTTCTTGCCACCCAGCTTGGTGCTAAACTTACCGAGGTTCGAAAGAA
TGGCACTTGCCCTTGGTTGAGGCCTGATGGCAAGACACAAGTTACTGTTG
AGTATTACAATGAGAATGGTGCTATGGTTCCTGTGAGAGTTCACACAGTT
TTGATCTCTACTCAGCATGACGAAACTGTGACTAATGATGAGATCGCTGC
TGATTTGAAAGAGCATGTGATCAAGCCTGTTATTCCTGAGAAGTACCTTG
ATGAGAAGACTATCTTCCATCT
back to top