DY262461

Overview
NameDY262461
Unique NameDY262461
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1328
Libraries
Library NameType
CitNFLcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY262461 vs. ExPASy Swiss-Prot
Match: G11A_ORYSJ (Protein kinase G11A OS=Oryza sativa subsp. japonica GN=Os06g0291600 PE=2 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 6.298e-66
Identity = 151/316 (47.78%), Postives = 190/316 (60.13%), Query Frame = 1
Query:  250 RIGSGDIGSVYLTELKNQDSKSINNNSLFAAKVMDKKELASRSKEGRARTEREILELLDHPFLPTLYASIDSQRWLCLLTEFCPGGDLHVLRQRQRNKRFDEAAVRFYASEVVIALEYLHMLGIVYRDLKPENVLVRSDGHIMLTDFDLSLKCDDSASNAQIISDQNPPIVVLQ--NEYLVDHPPFTSASCII-PNCIVPAVSCFRPKRXRKKKTGQ----------HSGPEFVVEPVDVRSMSFVGTTSIWRRRLCPVRVMEVLGIGD-----TRGYFI-QLFYGVTPFKGGDHELTLAKIL------PSSPSVS 1122
            ++G GDIGSVYL+EL           S FA KVMDK  LASR K  RA+TE+EIL+ LDHPFLPTLY   ++ ++ CL+ EFCPGGDLH LRQRQR K F E AV+FY +E+++A+EYLHMLGI+YRDLKPENVLVR DGHIML+DFDLSL+C   A +  +I   NP    L+  N+     P     SC+I P+C  P  +CF P+   K K  +             PE + EP D RSMSFVGT       L P  +++  G G      T G F+ +L +G TPFKG  +  TL  ++      P  P VS
Sbjct:  200 KLGCGDIGSVYLSELSG-------TKSYFAMKVMDKASLASRKKLLRAQTEKEILQCLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHTLRQRQRGKYFPEQAVKFYVAEILLAMEYLHMLGIIYRDLKPENVLVREDGHIMLSDFDLSLRC---AVSPTLIRSSNPDAEALRKNNQAYCVQPACVEPSCMIQPSCATP-TTCFGPRFFSKSKKDRKPKPEVVNQVSPWPELIAEPSDARSMSFVGT----HEYLAP-EIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNVIGQPLRFPEYPVVS 499          
BLAST of DY262461 vs. ExPASy Swiss-Prot
Match: G11A_ORYSI (Protein kinase G11A OS=Oryza sativa subsp. indica GN=OsI_021818 PE=2 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 6.298e-66
Identity = 151/316 (47.78%), Postives = 190/316 (60.13%), Query Frame = 1
Query:  250 RIGSGDIGSVYLTELKNQDSKSINNNSLFAAKVMDKKELASRSKEGRARTEREILELLDHPFLPTLYASIDSQRWLCLLTEFCPGGDLHVLRQRQRNKRFDEAAVRFYASEVVIALEYLHMLGIVYRDLKPENVLVRSDGHIMLTDFDLSLKCDDSASNAQIISDQNPPIVVLQ--NEYLVDHPPFTSASCII-PNCIVPAVSCFRPKRXRKKKTGQ----------HSGPEFVVEPVDVRSMSFVGTTSIWRRRLCPVRVMEVLGIGD-----TRGYFI-QLFYGVTPFKGGDHELTLAKIL------PSSPSVS 1122
            ++G GDIGSVYL+EL           S FA KVMDK  LASR K  RA+TE+EIL+ LDHPFLPTLY   ++ ++ CL+ EFCPGGDLH LRQRQR K F E AV+FY +E+++A+EYLHMLGI+YRDLKPENVLVR DGHIML+DFDLSL+C   A +  +I   NP    L+  N+     P     SC+I P+C  P  +CF P+   K K  +             PE + EP D RSMSFVGT       L P  +++  G G      T G F+ +L +G TPFKG  +  TL  ++      P  P VS
Sbjct:  200 KLGCGDIGSVYLSELNG-------TKSYFAMKVMDKASLASRKKLLRAQTEKEILQCLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHTLRQRQRGKYFPEQAVKFYVAEILLAMEYLHMLGIIYRDLKPENVLVREDGHIMLSDFDLSLRC---AVSPTLIRSSNPDAEALRKNNQAYCVQPACVEPSCMIQPSCATP-TTCFGPRFFSKSKKDRKPKPEVVNQVSPWPELIAEPSDARSMSFVGT----HEYLAP-EIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNVIGQPLRFPEYPVVS 499          
BLAST of DY262461 vs. ExPASy Swiss-Prot
Match: KPK7_ARATH (Putative serine/threonine-protein kinase PK7 OS=Arabidopsis thaliana GN=PK7 PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 4.513e-64
Identity = 145/319 (45.45%), Postives = 192/319 (60.19%), Query Frame = 1
Query:  232 DIRFSLRIGSGDIGSVYLTELKNQDSKSINNNSLFAAKVMDKKELASRSKEGRARTEREILELLDHPFLPTLYASIDSQRWLCLLTEFCPGGDLHVLRQRQRNKRFDEAAVRFYASEVVIALEYLHMLGIVYRDLKPENVLVRSDGHIMLTDFDLSLKCDDSASNAQIISDQNPPIVVLQNEYLVDHPPFTSASCII-PNCIVPAVSCFRPKRXRKKKTGQHSG---------PEFVVEPVDVRSMSFVGTTSIWRRRLCPVRVMEVLGIGD-----TRGYFI-QLFYGVTPFKGGDHELTLAKIL------PSSPSVS 1122
            D +   ++G GDIG+VYL EL       I     FA KVM+K  +A+R K  RA+TE+EIL+ LDHPFLPTLY+  +++   CL+ EFCPGGDLH LRQ+QR K F E A RFY +EV++A+EYLHMLGI+YRDLKPENVLVR DGHIML+DFDLSL+C   A +  ++      +    + Y +       +SCI+ P+CI P   CF P+   K K  + S          PE + EP   RSMSFVGT       L P  +++  G G      T G F+ +L +G+TPF+GGD+  TL  ++      P  P+VS
Sbjct:  181 DFKLIKKLGGGDIGNVYLAEL-------IGTGVSFAVKVMEKAAIAARKKLVRAQTEKEILQSLDHPFLPTLYSHFETEMNSCLVMEFCPGGDLHSLRQKQRGKYFPEQAARFYVAEVLLAMEYLHMLGIIYRDLKPENVLVREDGHIMLSDFDLSLRC---AVSPTLVRFAAITLESKSSSYCIQPTCVDQSSCIVQPDCIQPV--CFTPRFLSKGKHRKKSNDMSRQIRPLPELIAEPTSARSMSFVGT----HEYLAP-EIIKGEGHGSAVDWWTFGIFLYELLFGITPFRGGDNRATLFNVVGQPLRFPEHPNVS 482          
BLAST of DY262461 vs. ExPASy Swiss-Prot
Match: KPK1_PHAVU (Protein kinase PVPK-1 OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 5.895e-64
Identity = 153/321 (47.66%), Postives = 194/321 (60.44%), Query Frame = 1
Query:  238 RFSLRIGSGDIGSVYLTELKNQDSKSINNNSLFAAKVMDKKELASRSKEGRARTEREILELLDHPFLPTLYASIDSQRWLCLLTEFCPGGDLHVLRQRQRNKRFDEAAVRFYASEVVIALEYLHMLGIVYRDLKPENVLVRSDGHIMLTDFDLSLKCDDSASNAQIISDQNPPIVVLQNEYLVDHPPFTSASCII-PNCIVPAVSCFRPK---------RXRKKKTGQHSG----PEFVVEPVDVRSMSFVGTTSIWRRRLCPVRVMEVLGIGD-----TRGYFI-QLFYGVTPFKGGDHELTLAKIL------PSSPSVS 1122
            R   ++G GDIGSVYL EL           + FA KVM+K ELA+R K  RA+TEREIL+ LDHPFLPTLY   +++ + CL+ EFCPGGDLH LRQRQ  K F E AVRFY +EV+++LEYLHMLGI+YRDLKPENVLVR DGHIML+DFDLSL+C  S S   + S  N  +    + Y V  P     +C++ P+CI P  SCF P+         +  K K   H+     PE + EP + RSMSFVGT       L P  +++  G G      T G F+ +L +G TPFKG  +  TL  ++      P SP+VS
Sbjct:  230 RLLKKLGCGDIGSVYLAELSG-------TRTSFAMKVMNKTELANRKKLLRAQTEREILQSLDHPFLPTLYTHFETEIFSCLVMEFCPGGDLHALRQRQPGKYFSEHAVRFYVAEVLLSLEYLHMLGIIYRDLKPENVLVREDGHIMLSDFDLSLRC--SVSPTLVKSSNN--LQTKSSGYCV-QPSCIEPTCVMQPDCIKP--SCFTPRFLSGKSKKDKKSKPKNDMHNQVTPLPELIAEPTNARSMSFVGT----HEYLAP-EIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSANRATLFNVIGQPLRFPESPTVS 531          
BLAST of DY262461 vs. ExPASy Swiss-Prot
Match: PHOT2_ARATH (Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2)

HSP 1 Score: 186.808 bits (473), Expect = 2.488e-46
Identity = 123/304 (40.46%), Postives = 155/304 (50.99%), Query Frame = 1
Query:  253 IGSGDIGSVYLTELKNQDSKSINNNSLFAAKVMDKKELASRSKEGRARTEREILELLDHPFLPTLYASIDSQRWLCLLTEFCPGGDLHVLRQRQRNKRFDEAAVRFYASEVVIALEYLHMLGIVYRDLKPENVLVRSDGHIMLTDFDLSLKCDDSASNAQIISDQNPPIVVLQNEYLVDHPPFTSASCIIPNCIVPAVSCFRPKRXRKKKTGQHSGPEFVVEPVDVRSMSFVGTTSIWRRRLCPVRVMEVLGIGDTRG--------YFIQLFYGVTPFKGGDHELTLAKIL------PSSPSVS 1122
            +GSGD GSV+L ELK           L+A K M+K  + +R+K  RA  EREI+ LLDHPFLPTLYAS  +   +CL+T+FCPGG+L  L  RQ  K   E + RFYA+EVVI LEYLH LGIVYRDLKPEN+L++ DGHI+L DFDLS                                     +   P  I+PA     P + R+ K+     P FV EP   +S SFVGT       +       + G G T             ++ YG TPF+G + + T A IL      PSS  VS
Sbjct:  583 LGSGDTGSVHLVELKG-------TGELYAMKAMEKTMMLNRNKAHRACIEREIISLLDHPFLPTLYASFQTSTHVCLITDFCPGGELFALLDRQPMKILTEDSARFYAAEVVIGLEYLHCLGIVYRDLKPENILLKKDGHIVLADFDLSF-----------------------------------MTTCTPQLIIPAA----PSKRRRSKS--QPLPTFVAEP-STQSNSFVGTEEYIAPEI-------ITGAGHTSAIDWWALGILLYEMLYGRTPFRGKNRQKTFANILHKDLTFPSSIPVS 830          
BLAST of DY262461 vs. ExPASy Swiss-Prot
Match: PHOT1_ARATH (Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 3.972e-44
Identity = 112/291 (38.49%), Postives = 153/291 (52.58%), Query Frame = 1
Query:  253 IGSGDIGSVYLTELKNQDSKSINNNSLFAAKVMDKKELASRSKEGRARTEREILELLDHPFLPTLYASIDSQRWLCLLTEFCPGGDLHVLRQRQRNKRFDEAAVRFYASEVVIALEYLHMLGIVYRDLKPENVLVRSDGHIMLTDFDLSLKCDDSASNAQIISDQNPPIVVLQNEYLVDHPPFTSASCIIPNCIVPAVSCFRPKRXRKKKTGQHSGPEFVVEPVDVRSMSFVGTTSIWRRRLCPVRVMEVLGIGDTRG--------YFIQLFYGVTPFKGGDHELTLAKIL 1101
            +GSGD GSV+L EL       +  + LFA K MDK  + +R+K  RAR EREIL+LLDHPFLP LYAS  ++  +CL+T++ PGG+L +L  RQ  K   E AVRFYA++VV+ALEYLH  GI+YRDLKPENVL++ +G I L+DFDLS  C  S                                   P  ++P++     ++ +KK+      P F+ EP+   S SFVGT       +       + G G T             ++ YG TPF+G   + T   +L
Sbjct:  669 LGSGDTGSVHLVEL-------VGTDQLFAMKAMDKAVMLNRNKVHRARAEREILDLLDHPFLPALYASFQTKTHICLITDYYPGGELFMLLDRQPRKVLKEDAVRFYAAQVVVALEYLHCQGIIYRDLKPENVLIQGNGDISLSDFDLS--CLTSCK---------------------------------PQLLIPSID----EKKKKKQQKSQQTPIFMAEPMRA-SNSFVGTEEYIAPEI-------ISGAGHTSAVDWWALGILMYEMLYGYTPFRGKTRQKTFTNVL 905          
BLAST of DY262461 vs. ExPASy Swiss-Prot
Match: NRC2_NEUCR (Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa GN=nrc-2 PE=3 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 4.703e-37
Identity = 100/283 (35.34%), Postives = 131/283 (46.29%), Query Frame = 1
Query:  253 IGSGDIGSVYLTELKNQDSKSINNNSLFAAKVMDKKELASRSKEGRARTEREILELLDHPFLPTLYASIDSQRWLCLLTEFCPGGDLHVLRQRQRNKRFDEAAVRFYASEVVIALEYLHMLGIVYRDLKPENVLVRSDGHIMLTDFDLSLKCDDSASNAQIISDQNPPIVVLQNEYLVDHPPFTSASCIIPNCIVPAVSCFRPKRXRKKKTGQHSGPEFVVEPVDVRSMSFVGTTSIWRRRLCPVRVMEVLGIGDTRGYFIQLFYGVTPFKGGDHELTLAKIL 1101
            IG GD+G VYL + K        +  L+A KV+ KKE+  R+K  RA  E+EIL   +HPF+ TLY S  S+ +L L  E+C GG+     Q +  K   E   RFYA+EV  ALEYLH++G +YRDLKPEN+L+   GHIML+DFDLS + D       II         L        P   + SCI                    +T    G E  + P  ++          W            LGI        ++ YG TPFKG +   T A IL
Sbjct:  248 IGKGDVGKVYLVKEKK-------SGRLYAMKVLSKKEMIKRNKIKRALAEQEILATSNHPFIVTLYHSFQSEDYLYLCMEYCSGGEFFRALQTRPGKCIPEDDARFYAAEVTAALEYLHLMGFIYRDLKPENILLHQSGHIMLSDFDLSKQSDPGGKPTMIIGKNGTSTSSL--------PTIDTKSCI-----------------ANFRTNSFVGTEEYIAPEVIKGSGHTSAVDWW-----------TLGI-----LIYEMLYGTTPFKGKNRNATFANIL 482          
BLAST of DY262461 vs. ExPASy Swiss-Prot
Match: PPK14_SCHPO (Serine/threonine-protein kinase ppk14 OS=Schizosaccharomyces pombe GN=ppk14 PE=1 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 1.368e-36
Identity = 100/283 (35.34%), Postives = 138/283 (48.76%), Query Frame = 1
Query:  253 IGSGDIGSVYLTELKNQDSKSINNNSLFAAKVMDKKELASRSKEGRARTEREILELLDHPFLPTLYASIDSQRWLCLLTEFCPGGDLHVLRQRQRNKRFDEAAVRFYASEVVIALEYLHMLGIVYRDLKPENVLVRSDGHIMLTDFDLSLKCDDSASNAQIISDQNPPIVVLQNEYLVDHPPFTSASCIIPNCIVPAVSCFRPKRXRKKKTGQHSGPEFVVEPVDVRSMSFVGTTSIWRRRLCPVRVMEVLGIGDTRGYFIQLFYGVTPFKGGDHELTLAKIL 1101
            +G GD+G VYL   K        +   +A KV+ K+E+  R+K  RA  E+ IL   +HPF+ TLY S  S  +L L  E+C GG+     QR+  +   E   +FY +EV  ALEYLH++G +YRDLKPEN+L+   GHIML+DFDLS K  +SA    +I  +N P    QN Y +D     + SCI         + FR        T    G E  + P  ++          W            LGI      F ++ Y  TPFKG +  +T + IL
Sbjct:  201 LGKGDVGRVYLVREKK-------SGKFYAMKVLSKQEMIKRNKSKRAFAEQHILATSNHPFIVTLYHSFQSDEYLYLCMEYCMGGEFFRALQRRPGRCLSENEAKFYIAEVTAALEYLHLMGFIYRDLKPENILLHESGHIMLSDFDLS-KQSNSAGAPTVIQARNAPSA--QNAYALD-----TKSCI---------ADFR--------TNSFVGTEEYIAPEVIKGCGHTSAVDWW-----------TLGI-----LFYEMLYATTPFKGKNRNMTFSNIL 435          
BLAST of DY262461 vs. ExPASy Swiss-Prot
Match: KIN82_YEAST (Probable serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae GN=KIN82 PE=1 SV=2)

HSP 1 Score: 147.132 bits (370), Expect = 2.185e-34
Identity = 74/155 (47.74%), Postives = 103/155 (66.45%), Query Frame = 1
Query:  253 IGSGDIGSVYLTELKNQDSKSINNNSLFAAKVMDKKELASRSKEGRARTEREILELLDHPFLPTLYASIDSQRWLCLLTEFCPGGDLHVLRQRQRNKRFDEAAVRFYASEVVIALEYLHMLGIVYRDLKPENVLVRSDGHIMLTDFDLSLKCDDS 717
            +G GD+G VYL  ++ +D+     N +FA KV++K E+  R K  R  TE+EIL   DHPF+ TLY S  ++ +L L  E+C GG+     Q +++K   E   +FYASEVV ALEYLH+LG +YRDLKPEN+L+   GH+ML+DFDLS++   S
Sbjct:  330 LGQGDVGKVYL--MRERDT-----NQIFALKVLNKHEMIKRKKIKRVLTEQEILATSDHPFIVTLYHSFQTKDYLYLCMEYCMGGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLLGFIYRDLKPENILLHQSGHVMLSDFDLSIQATGS 477          
BLAST of DY262461 vs. ExPASy Swiss-Prot
Match: KN8R_YEAST (Probable serine/threonine-protein kinase YNR047W OS=Saccharomyces cerevisiae GN=YNR047W PE=1 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 2.853e-34
Identity = 98/293 (33.45%), Postives = 133/293 (45.39%), Query Frame = 1
Query:  253 IGSGDIGSVYLTELKNQDSKSINNNSLFAAKVMDKKELASRSKEGRARTEREILELLDHPFLPTLYASIDSQRWLCLLTEFCPGGDLHVLRQRQRNKRFDEAAVRFYASEVVIALEYLHMLGIVYRDLKPENVLVRSDGHIMLTDFDLSLKCDDSASNAQIISDQNPPIVVLQNEYLVDHPPFTSASCIIPNCIVPAVSCFRPKRXRKKKTGQHSGPEFVVEPVDVRSMSFVGTTSIWRRRLCPVRVMEVLGIGDTRGYFIQLFYGVTPFKGGDHELTLAKILPSSPSVSQGN 1131
            +G GD+G V+L   K         N ++A KV+ K E+  R+K  R  TE+EIL   +HPF+ TLY S  S+ +L L  E+C GG+     Q ++ K   E   RFYASEV  ALEYLH+LG +YRDLKPEN+L+   GHIML+DFDLS++  DS         + P +       LVD    +                         +T    G E  + P  +R          W            LGI        ++ +G TPFKG +   T   IL +  S    N
Sbjct:  502 LGQGDVGKVFLVREKK-------TNRVYALKVLSKDEMIKRNKIKRVLTEQEILATSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCICEDDARFYASEVTAALEYLHLLGFIYRDLKPENILLHQSGHIMLSDFDLSIQAKDS---------KVPVVKGSAQSTLVDTKICSDGF----------------------RTNSFVGTEEYIAPEVIRGNGHTAAVDWW-----------TLGI-----LIYEMLFGFTPFKGDNTNETFTNILKNEVSFPNNN 740          
The following BLAST results are available for this feature:
BLAST of DY262461 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 483
Match NameE-valueIdentityDescription
G11A_ORYSJ6.298e-6647.78Protein kinase G11A OS=Oryza sativa subsp. japonic... [more]
G11A_ORYSI6.298e-6647.78Protein kinase G11A OS=Oryza sativa subsp. indica ... [more]
KPK7_ARATH4.513e-6445.45Putative serine/threonine-protein kinase PK7 OS=Ar... [more]
KPK1_PHAVU5.895e-6447.66Protein kinase PVPK-1 OS=Phaseolus vulgaris PE=2 S... [more]
PHOT2_ARATH2.488e-4640.46Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=... [more]
PHOT1_ARATH3.972e-4438.49Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=... [more]
NRC2_NEUCR4.703e-3735.34Serine/threonine-protein kinase nrc-2 OS=Neurospor... [more]
PPK14_SCHPO1.368e-3635.34Serine/threonine-protein kinase ppk14 OS=Schizosac... [more]
KIN82_YEAST2.185e-3447.74Probable serine/threonine-protein kinase KIN82 OS=... [more]
KN8R_YEAST2.853e-3433.45Probable serine/threonine-protein kinase YNR047W O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionIC0AAA100AB09RM1 CitNFL Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY262461 ID=DY262461|Name=DY262461|organism=Citrus clementina|type=EST|length=1328bp
CTCTCTTTCTCTCTCTGCAGTTCAATGGAGCCATGGCTCGACGACTTATC
CGACGATTTACAGAGCGTGAGTTTCACGTCCACGAACACGACCGCCACAA
CGATCAACCGCAGCACAAGCTCGGGCTCCTTCGACGCCACCGCCTCACTC
ACCCCGGCTCCCTCCGCTCACAGCTCCTTCTCCTCCAAACCCAAATCCAC
CACTACAACAACTCACTCTCTCTCCTTCTCCGACATCCGCTTCTCCCTCC
GCATCGGCTCCGGCGACATCGGCTCCGTCTACTTAACCGAGCTCAAAAAC
CAAGACAGCAAAAGCATTAACAACAACTCTCTCTTCGCCGCTAAAGTGAT
GGACAAAAAAGAACTCGCTTCGAGAAGCAAAGAAGGCAGAGCAAGGACTG
AGCGGGAAATTCTGGAACTGTTGGACCATCCATTTTTGCCCACGCTTTAC
GCCAGTATAGACTCGCAGAGGTGGCTCTGTTTGTTAACGGAGTTCTGCCC
CGGCGGTGACCTCCACGTCCTCCGTCAACGCCAGCGTAATAAACGGTTCG
ATGAAGCCGCCGTCAGATTCTACGCATCGGAGGTGGTGATAGCGCTAGAA
TACCTTCACATGTTGGGAATTGTCTACCGTGATCTGAAGCCAGAAAATGT
GCTCGTTCGATCAGACGGACACATTATGCTAACGGACTTTGATCTGTCGT
TAAAATGTGATGATTCTGCATCAAATGCTCAGATTATTTCTGATCAAAAC
CCACCAATTGTGGTCCTACAAAATGAGTATCTAGTTGATCATCCTCCATT
CACATCCGCTTCATGCATTATTCCAAATTGCATTGTCCCTGCCGTGTCAT
GTTTTCGACCCAAGCGCANGCGGAAAAAGAAGACGGGCCAGCATAGTGGG
CCTGAATTTGTAGTCGAACCTGTTGATGTCCGGTCCATGTCATTTGTTGG
GACCACGAGTATTTGGCGCCGGAGATTGTGTCCGGTGAGGGTCATGGAAG
TCCTGGGGATTGGTGACACTAGGGGATATTTTATCCAACTATTTTATGGG
GTGACCCCCTTTAAGGGTGGGGACCACGAGCTAACTCTAGCTAAAATCCT
CCCCTCGAGCCCCTCAGTTTCCCAAGGGAACCGGGCCGGGGCCGCCCCGC
GGCAAAGGGCCCTGATTCTCCCAAAAAATATGGGCCAAGGGATCCGCAAA
AAGGGGGATAGGGGGGCCCCCAAAAGGGGGGCGGGCGCGGGCAAACCAAA
AACCCCACCCCCATTTTTTTTTTAGGGGGGGGGGAAAAAATGTGGGGGGG
GATGTGGGGAGGAAGGAAAAAGAAGCCC
back to top