DY262462

Overview
NameDY262462
Unique NameDY262462
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length880
Libraries
Library NameType
CitNFLcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12772 contig Ccv1_Contig12772:349..1217. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY262462 vs. ExPASy Swiss-Prot
Match: CB11_SOLLC (Chlorophyll a-b binding protein 6A, chloroplastic OS=Solanum lycopersicum GN=CAB6A PE=2 SV=1)

HSP 1 Score: 393.66 bits (1010), Expect = 7.452e-109
Identity = 191/229 (83.41%), Postives = 203/229 (88.65%), Query Frame = 3
Query:    3 LMSCGIATTAFPSVLSSSKSKFFTAVSL-PAAANATSKYAMSADWMPGEPRPPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVPGILVPEALGLGNWVQAQEWAAVPGGQATYLGTPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKKYPGGAFDPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNN 686
            LMSCGI     PS LSS+KSKF  A+ +   A N  S+++MSADWMPG+PRP YLDGSAPGDFGFD L LGEVP NLERYKESELIHCRWAMLAVPGI+VPEALGLGNWV+AQEWAA+PGGQATYLG PVPWGTLPTIL IEFL+IAFVEHQRSMEKD EKKKYPGGAFDPLG+SKDP KFEE KVKEIKNGRLALLA VGFCVQQSAY GTGPLENLATHLADPWHNN
Sbjct:    6 LMSCGIPAVC-PSFLSSTKSKFAAAMPVYVGATNFMSRFSMSADWMPGQPRPSYLDGSAPGDFGFDSLGLGEVPANLERYKESELIHCRWAMLAVPGIIVPEALGLGNWVKAQEWAAIPGGQATYLGQPVPWGTLPTILAIEFLAIAFVEHQRSMEKDSEKKKYPGGAFDPLGYSKDPAKFEELKVKEIKNGRLALLAIVGFCVQQSAYLGTGPLENLATHLADPWHNN 233          
BLAST of DY262462 vs. ExPASy Swiss-Prot
Match: CB121_HORVU (Chlorophyll a-b binding protein 1B-21, chloroplastic OS=Hordeum vulgare GN=LHC Ib-21 PE=1 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 5.353e-99
Identity = 169/228 (74.12%), Postives = 189/228 (82.89%), Query Frame = 3
Query:    3 LMSCGIATTAFPSVLSSSKSKFFTAVSLPAAANATSKYAMSADWMPGEPRPPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVPGILVPEALGLGNWVQAQEWAAVPGGQATYLGTPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKKYPGGAFDPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNN 686
            L SC  +    PS+L+ S     + +   A A  + +  MSA+W PG+PRP +LDGS+PGDFGFDPL L  VPEN ER+KESE+ HCRWAML VPG+LVPEALGLGNWV+AQEWAA+P GQATYLG PVPWG LPTIL IEFL+IAF E QR+MEKDPEKKKYPGGAFDPLGFSKDP KFEE K+KEIKNGRLA+LAFVGFCVQQSAYPGTGPLENLATHLADPWHNN
Sbjct:    7 LRSC--SAVGVPSLLAPSSRSGRSGLPFCAYATTSGRVTMSAEWFPGQPRPAHLDGSSPGDFGFDPLGLATVPENFERFKESEIYHCRWAMLCVPGVLVPEALGLGNWVKAQEWAALPDGQATYLGNPVPWGNLPTILAIEFLAIAFAEQQRTMEKDPEKKKYPGGAFDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATHLADPWHNN 232          
BLAST of DY262462 vs. ExPASy Swiss-Prot
Match: CB24_ARATH (Chlorophyll a-b binding protein 4, chloroplastic OS=Arabidopsis thaliana GN=CAB4 PE=1 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 2.214e-36
Identity = 94/241 (39.00%), Postives = 130/241 (53.94%), Query Frame = 3
Query:   27 TAFPSVLSSSKSKF-----FTAVSLPAAANATSKYAMSADWMPGEPRPPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVPGILVPEALGLGNWVQAQEWAAVPGGQATYLGTPVPWGTLPTILVIEFLSIAFVEHQR--------SMEKDPEKKK---------YPGGAFDPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHN 683
            T+ P  L+ S  +      FT++   A  ++    A   +W+PG   P YL GS  GD GFDPL L E PENL+ + ++EL++ RWAML V G+L+PE       +   EW     G+  Y      + +  T+ VIEF+   +VE +R        S+ +DP  K+         YPGG F+PL F+      +E K KE+ NGRLA+LAF+GF VQ +   G GP ENL  HL+DPWHN
Sbjct:   17 TSKPRFLTGSSGRLNRDLSFTSIGSSAKTSSFKVEAKKGEWLPGLASPDYLTGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIGIINVPEW--YDAGKEQY------FASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPKGEVGYPGGIFNPLNFAPT----QEAKEKELANGRLAMLAFLGFVVQHNV-TGKGPFENLLQHLSDPWHN 244          
BLAST of DY262462 vs. ExPASy Swiss-Prot
Match: CB4A_ARATH (Chlorophyll a-b binding protein CP29.1, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.1 PE=1 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 6.441e-36
Identity = 100/255 (39.22%), Postives = 134/255 (52.55%), Query Frame = 3
Query:   69 FTAV----SLPAAANATSKYAMSAD---WMPGEPRPPYLDGSAPGDFGFDPLRLGEVPENLE-------------------------------------------RYKESELIHCRWAMLAVPGILVPEALGLGNWVQAQEWAAVPGGQATYLGTPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKKYPGGAF-DPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWH 680
            FTAV       AA   ++K  ++ D   W PG   P +LDGS  GD+GFDP  LG+  E L+                                           R++E ELIH RWAMLA  G L  E L    W  A +   V G  ++YLG P+P+ ++ T++ IE L I ++E QR+ E D EK+ YPGG F DPLG + DP+K  + ++ EIK+ RLA++AF+GF VQ +A  G GPL N ATHL+DP H
Sbjct:   30 FTAVFGFGKKKAAPKKSAKKTVTTDRPLWYPGAISPDWLDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVIGTRTEAADAKSTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKVELVDG--SSYLGQPLPF-SISTLIWIEVLVIGYIEFQRNAELDSEKRLYPGGKFFDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAA-TGKGPLNNWATHLSDPLH 280          
BLAST of DY262462 vs. ExPASy Swiss-Prot
Match: CB4B_ARATH (Chlorophyll a-b binding protein CP29.2, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.2 PE=1 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 1.099e-35
Identity = 100/259 (38.61%), Postives = 131/259 (50.58%), Query Frame = 3
Query:   51 SSKSKFFTAVSLPAAANATSKYAMSAD-----WMPGEPRPPYLDGSAPGDFGFDPLRLGEVPE-------------------------------------------NLERYKESELIHCRWAMLAVPGILVPEALGLGNWVQAQEWAAVPGGQATYLGTPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKKYPGGAF-DPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWH 680
            SS S  FTA        A+ K A +       W PG   P YLDGS  GD+GFDP  LG+  E                                            L+R++E ELIH RWAMLA  G +  E L    W  A +   V G  ++YLG P+P+ ++ T++ IE L I ++E QR+ E D EK+ YPGG F DPLG + DP K  + ++ EIK+ RLA++ F+GF VQ +A  G GPL N ATHL+DP H
Sbjct:   23 SSNSSRFTARFGFGTKKASPKKAKTVISDRPLWFPGAKSPEYLDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLYGEVIGTRTEAVDPKSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGAITVEWLTGVTWQDAGKVELVDG--SSYLGQPLPF-SISTLIWIEVLVIGYIEFQRNAELDSEKRLYPGGKFFDPLGLASDPVKKAQLQLAEIKHARLAMVGFLGFAVQAAA-TGKGPLNNWATHLSDPLH 277          
BLAST of DY262462 vs. ExPASy Swiss-Prot
Match: CB12_SOLLC (Chlorophyll a-b binding protein 7, chloroplastic OS=Solanum lycopersicum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.587e-34
Identity = 94/245 (38.37%), Postives = 125/245 (51.02%), Query Frame = 3
Query:   39 SVLSSSKSKFFTAVSLPAAANATSKYAMSAD------------WMPGEPRPPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVPGILVPEALGLGNWVQAQEWAAVPGGQATYLGTPVPWGTLPTILVIEFLSIAFVEHQR--------SMEKDP---------EKKKYPGGA-FDPLGF-SKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWH 680
            S++ ++K+ F     L  +  +T+  A SA             W PG   PP+LDGS PGDFGFDPL L   PE+L   +++EL+HCRWAML   GI +PE L     +    W    G Q  +  T        T+ ++E + I + E +R         +  DP             YPGG  FDPLG+ S  P K +E + KEIKNGRLA+LA +G   Q   Y GTGP++NL  HLADP H
Sbjct:   25 SIVGTTKASFLGGRRLRVSKYSTTPTARSATTVCVAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTA-GEQEYFTDT-------TTLFIVELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQH-IYTGTGPIDNLFAHLADPGH 260          
BLAST of DY262462 vs. ExPASy Swiss-Prot
Match: CB120_HORVU (Chlorophyll a-b binding protein 1B-20, chloroplastic (Fragment) OS=Hordeum vulgare GN=LHC Ib-20 PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.072e-34
Identity = 79/193 (40.93%), Postives = 109/193 (56.48%), Query Frame = 3
Query:  132 WMPGEPRPPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVPGILVPEALGLGNWVQAQEWAAVPGGQATYLGTPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKK---------YPGGAFDPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHN 683
            W+PG   P YLDGS  GD GFDPL L E PE+L  + ++++++ RWAML V G+L+PE L     + A EW  +PG +  +  +        +   +E      +++  S+ +DP  K          YPG  F+PL F+       E K KE+ NGRLA+LAF+GF VQ + + G GP ENL  HLADPWHN
Sbjct:   36 WLPGLQSPAYLDGSLEGDNGFDPLALAEDPEDLRWFVQADVVNGRWAMLGVAGMLIPEVLTKAGLMNAPEWLRLPGKETYFASSSTALRVHMSSTYVEIRRWQDIKNPGSVNQDPIFKSYSLPPHECGYPGRVFNPLNFAP-----LENKEKELANGRLAMLAFLGFLVQHNVH-GKGPFENLQQHLADPWHN 222          
BLAST of DY262462 vs. ExPASy Swiss-Prot
Match: CB24_PEA (Chlorophyll a-b binding protein P4, chloroplastic OS=Pisum sativum GN=lhcA-P4 PE=1 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.706e-34
Identity = 91/234 (38.89%), Postives = 127/234 (54.27%), Query Frame = 3
Query:   45 LSSSKSKFFTAVSL-PAAANATSKYAMSA---DWMPGEPRPPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVPGILVPEALGLGNWVQAQEWAAVPGGQATYLGTPVPWGTLPTILVIEFLSIAFVEHQR--------SMEKDPEKKK---------YPGGAFDPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHN 683
            L  S  K    V+  P   + ++ + + A   +W+PG   P YL GS PGD GFDPL L E PENL  + ++EL++ RWAML V G+L+PE       +   +W A   G+  Y      + +  T+ VIEF+   +VE +R        S+ +DP  K+         YPGG F+PL F+       E K KEI NGRLA+LAF+GF +Q +   G GP +NL  H++DPWHN
Sbjct:   23 LGGSSGKLNRGVAFRPVGCSPSASFKVEAKKGEWLPGLASPGYLTGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYA--AGKEEY------FASSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQDPIFKQYSLPAGEVGYPGGIFNPLNFAPT----LEAKEKEIANGRLAMLAFLGFIIQHNV-TGKGPFDNLLQHISDPWHN 243          
BLAST of DY262462 vs. ExPASy Swiss-Prot
Match: CB26_ARATH (Chlorophyll a-b binding protein CP26, chloroplastic OS=Arabidopsis thaliana GN=LHCB5 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 7.874e-34
Identity = 82/186 (44.09%), Postives = 108/186 (58.06%), Query Frame = 3
Query:  153 PPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVPGILVPEALGL--GNWVQAQEW-----AAVPGGQATYLGTPVPWGTLPTILVIEFLSIAFVEHQR-SMEKDPEKKKYPGGAFDPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNN 686
            P YL+G   GD+G+DP  LG+ PEN  +Y+  ELIH RWAML   G ++PEAL     N      W       + G    Y G  +P   L   +V E + +   E+ R +   D E K +PGG FDPLG +KDP++    KVKEIKNGRLA+ A +GF + Q+   G GP+ENLA HL+DP+ NN
Sbjct:   82 PEYLNGEVAGDYGYDPFGLGKKPENFAKYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKNIPI-NLVLAVVAEVVLLGGAEYYRITNGLDFEDKLHPGGPFDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFI-QAYVTGEGPVENLAKHLSDPFGNN 265          
BLAST of DY262462 vs. ExPASy Swiss-Prot
Match: CB21_SINAL (Chlorophyll a-b binding protein 1, chloroplastic OS=Sinapis alba GN=CAB1 PE=3 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 2.291e-33
Identity = 89/195 (45.64%), Postives = 108/195 (55.38%), Query Frame = 3
Query:  141 GEPRPPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVPGILVPEAL-------GLGNWVQAQEWAAVPGGQATYLGTP--VPWGTLPTILVIEFLSIAFVEHQRSMEKDP----EKKKYPGGAFDPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNN 686
            GEP P YL G  PGD+G+D   L   PE   R +E E+IHCRWAML   G + PE L       G   W +A       GG   YLG P  V   ++  I   + + +  VE  R   + P    E   YPGG+FDPLG + DP+ F E KVKEIKNGRLA+ +  GF V Q+   G GPLENLA HLADP +NN
Sbjct:   63 GEP-PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGG-LDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGEGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKEIKNGRLAMFSMFGFFV-QAIVTGKGPLENLADHLADPVNNN 254          
The following BLAST results are available for this feature:
BLAST of DY262462 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
CB11_SOLLC7.452e-10983.41Chlorophyll a-b binding protein 6A, chloroplastic ... [more]
CB121_HORVU5.353e-9974.12Chlorophyll a-b binding protein 1B-21, chloroplast... [more]
CB24_ARATH2.214e-3639.00Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB4A_ARATH6.441e-3639.22Chlorophyll a-b binding protein CP29.1, chloroplas... [more]
CB4B_ARATH1.099e-3538.61Chlorophyll a-b binding protein CP29.2, chloroplas... [more]
CB12_SOLLC1.587e-3438.37Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB120_HORVU2.072e-3440.93Chlorophyll a-b binding protein 1B-20, chloroplast... [more]
CB24_PEA2.706e-3438.89Chlorophyll a-b binding protein P4, chloroplastic ... [more]
CB26_ARATH7.874e-3444.09Chlorophyll a-b binding protein CP26, chloroplasti... [more]
CB21_SINAL2.291e-3345.64Chlorophyll a-b binding protein 1, chloroplastic O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionIC0AAA100AB10RM1 CitNFL Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY262462 ID=DY262462|Name=DY262462|organism=Citrus clementina|type=EST|length=880bp
CTCTGATGAGCTGCGGCATCGCCACCACCGCTTTCCCTTCGGTCCTCTCA
TCTTCTAAATCCAAATTCTTTACTGCAGTTTCACTTCCAGCTGCCGCCAA
TGCAACCTCGAAATACGCCATGTCTGCTGACTGGATGCCCGGCGAGCCCC
GGCCGCCTTATCTTGATGGTTCAGCCCCAGGGGACTTTGGATTTGACCCA
CTTCGGCTTGGCGAAGTTCCTGAGAACCTTGAGAGATACAAGGAGTCTGA
ACTCATTCACTGCAGATGGGCTATGCTTGCTGTTCCAGGGATCTTGGTGC
CAGAGGCATTGGGATTGGGCAACTGGGTGCAGGCGCAAGAGTGGGCAGCA
GTTCCTGGAGGACAAGCCACATACTTAGGCACCCCTGTTCCATGGGGCAC
TCTCCCCACAATTTTGGTCATTGAATTCCTTTCCATTGCCTTCGTTGAGC
ACCAACGCAGCATGGAGAAAGACCCCGAGAAGAAGAAGTACCCCGGTGGT
GCTTTCGACCCCTTGGGCTTCTCCAAGGACCCCCAGAAGTTCGAGGAATA
CAAAGTCAAGGAGATAAAAAATGGGCGTTTGGCATTGCTGGCATTTGTGG
GTTTCTGCGTGCAACAATCAGCATATCCGGGCACAGGACCATTGGAGAAC
TTGGCAACTCACTTGGCTGATCCATGGCACAACAACATTGGGGACGTTAT
TATCCCCAGAGGGATTGTGCCTTGAAGAATTGCATTGTTAAATTATCCAA
TCCACTGTAAAATTCCCTGTTAAAAGAGCCTTTAATGAAACAGAATTCGT
ATCTTTCTGACTGTAAGATTAGAAAGTAATTGTCCTCCAATGACGTTCAT
GCTAGAATCTAATACTATTGTGATTGCCAT
back to top