DY271120
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY271120 vs. ExPASy Swiss-Prot
Match: PPIB_ASPNG (Peptidyl-prolyl cis-trans isomerase B OS=Aspergillus niger GN=cypB PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 2.837e-11 Identity = 34/59 (57.63%), Postives = 43/59 (72.88%), Query Frame = -2 Query: 26 LKGSMAEGGDFVKRDGTSGESIYEGKFPDESPRLKHDRPGLLSMSIADRDTLGSQFIIT 202 +K M +GGDF + DGT G+SIY KF DE+ +L+H R GLLSM+ A +DT GSQF IT Sbjct: 88 IKDFMIQGGDFTRGDGTGGKSIYGEKFADENFKLRHTRKGLLSMANAGKDTNGSQFFIT 146
BLAST of DY271120 vs. ExPASy Swiss-Prot
Match: PPIB_SCHPO (Peptidyl-prolyl cis-trans isomerase B OS=Schizosaccharomyces pombe GN=cyp4 PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 3.705e-11 Identity = 33/55 (60.00%), Postives = 40/55 (72.73%), Query Frame = -2 Query: 26 MAEGGDFVKRDGTSGESIYEGKFPDESPRLKHDRPGLLSMSIADRDTLGSQFIIT 190 M +GGD K DGT G+SIY +FPDE+ +L H RPGLLSM+ A D+ GSQF IT Sbjct: 84 MIQGGDITKGDGTGGKSIYGSRFPDENFKLSHQRPGLLSMANAGPDSNGSQFFIT 138
BLAST of DY271120 vs. ExPASy Swiss-Prot
Match: PPIB_EMENI (Peptidyl-prolyl cis-trans isomerase B OS=Emericella nidulans GN=cpr2 PE=3 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 3.705e-11 Identity = 33/59 (55.93%), Postives = 43/59 (72.88%), Query Frame = -2 Query: 26 LKGSMAEGGDFVKRDGTSGESIYEGKFPDESPRLKHDRPGLLSMSIADRDTLGSQFIIT 202 +K M +GGDF + DGT G+SIY KF DE+ +L+H + GLLSM+ A +DT GSQF IT Sbjct: 87 IKDFMIQGGDFTRGDGTGGKSIYGAKFKDENFKLRHTKTGLLSMANAGKDTNGSQFFIT 145
BLAST of DY271120 vs. ExPASy Swiss-Prot
Match: PPIB_CHICK (Peptidyl-prolyl cis-trans isomerase B OS=Gallus gallus GN=PPIB PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 3.705e-11 Identity = 33/59 (55.93%), Postives = 43/59 (72.88%), Query Frame = -2 Query: 26 LKGSMAEGGDFVKRDGTSGESIYEGKFPDESPRLKHDRPGLLSMSIADRDTLGSQFIIT 202 +K M +GGDF + DGT G+SIY +FPDE+ +LKH PG +SM+ A +DT GSQF IT Sbjct: 88 IKDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGPGWVSMANAGKDTNGSQFFIT 146
BLAST of DY271120 vs. ExPASy Swiss-Prot
Match: PPIA_STRCH (Peptidyl-prolyl cis-trans isomerase A OS=Streptomyces chrysomallus GN=ppiA PE=1 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 3.705e-11 Identity = 34/55 (61.82%), Postives = 42/55 (76.36%), Query Frame = -2 Query: 26 MAEGGDFVKRDGTSGESIYEGKFPDESPRLKHDRPGLLSMSIADRDTLGSQFIIT 190 M +GGDF + DGT G+SIY KF DE+ +LKHDR GLLSM+ A ++T GSQF IT Sbjct: 60 MLQGGDFTRGDGTGGKSIYGEKFADENFQLKHDRVGLLSMANAGKNTNGSQFFIT 114
BLAST of DY271120 vs. ExPASy Swiss-Prot
Match: PPID_HUMAN (40 kDa peptidyl-prolyl cis-trans isomerase OS=Homo sapiens GN=PPID PE=1 SV=3) HSP 1 Score: 69.3218 bits (168), Expect = 4.839e-11 Identity = 35/59 (59.32%), Postives = 42/59 (71.19%), Query Frame = -2 Query: 26 LKGSMAEGGDFVKRDGTSGESIYEGKFPDESPRLKHDRPGLLSMSIADRDTLGSQFIIT 202 +K M +GGDF ++GT GESIY KF DE+ KHDR GLLSM+ A R+T GSQF IT Sbjct: 77 IKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFIT 135
BLAST of DY271120 vs. ExPASy Swiss-Prot
Match: PPIB_RAT (Peptidyl-prolyl cis-trans isomerase B OS=Rattus norvegicus GN=Ppib PE=2 SV=3) HSP 1 Score: 69.3218 bits (168), Expect = 4.839e-11 Identity = 33/59 (55.93%), Postives = 43/59 (72.88%), Query Frame = -2 Query: 26 LKGSMAEGGDFVKRDGTSGESIYEGKFPDESPRLKHDRPGLLSMSIADRDTLGSQFIIT 202 +K M +GGDF + DGT G+SIY +FPDE+ +LKH PG +SM+ A +DT GSQF IT Sbjct: 97 IKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFIT 155
BLAST of DY271120 vs. ExPASy Swiss-Prot
Match: PPIB_MOUSE (Peptidyl-prolyl cis-trans isomerase B OS=Mus musculus GN=Ppib PE=2 SV=2) HSP 1 Score: 69.3218 bits (168), Expect = 4.839e-11 Identity = 33/59 (55.93%), Postives = 43/59 (72.88%), Query Frame = -2 Query: 26 LKGSMAEGGDFVKRDGTSGESIYEGKFPDESPRLKHDRPGLLSMSIADRDTLGSQFIIT 202 +K M +GGDF + DGT G+SIY +FPDE+ +LKH PG +SM+ A +DT GSQF IT Sbjct: 97 IKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFIT 155
BLAST of DY271120 vs. ExPASy Swiss-Prot
Match: PPIB_HUMAN (Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens GN=PPIB PE=1 SV=2) HSP 1 Score: 69.3218 bits (168), Expect = 4.839e-11 Identity = 33/59 (55.93%), Postives = 43/59 (72.88%), Query Frame = -2 Query: 26 LKGSMAEGGDFVKRDGTSGESIYEGKFPDESPRLKHDRPGLLSMSIADRDTLGSQFIIT 202 +K M +GGDF + DGT G+SIY +FPDE+ +LKH PG +SM+ A +DT GSQF IT Sbjct: 97 IKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFIT 155
BLAST of DY271120 vs. ExPASy Swiss-Prot
Match: PPIB_BOVIN (Peptidyl-prolyl cis-trans isomerase B OS=Bos taurus GN=PPIB PE=1 SV=4) HSP 1 Score: 69.3218 bits (168), Expect = 4.839e-11 Identity = 33/59 (55.93%), Postives = 43/59 (72.88%), Query Frame = -2 Query: 26 LKGSMAEGGDFVKRDGTSGESIYEGKFPDESPRLKHDRPGLLSMSIADRDTLGSQFIIT 202 +K M +GGDF + DGT G+SIY +FPDE+ +LKH PG +SM+ A +DT GSQF IT Sbjct: 97 IKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFIT 155 The following BLAST results are available for this feature:
BLAST of DY271120 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 23
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DY271120 ID=DY271120; Name=DY271120; organism=Citrus clementina; type=EST; length=1163bpback to top |