DY271120
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY271120 vs. ExPASy Swiss-Prot
Match: PPIB_DICDI (Peptidyl-prolyl cis-trans isomerase B OS=Dictyostelium discoideum GN=cypB PE=1 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 6.321e-11 Identity = 33/55 (60.00%), Postives = 41/55 (74.55%), Query Frame = -2 Query: 26 MAEGGDFVKRDGTSGESIYEGKFPDESPRLKHDRPGLLSMSIADRDTLGSQFIIT 190 M +GGDF + DGT GESIY KF DE+ ++KH +PGLLSM+ A +T GSQF IT Sbjct: 94 MIQGGDFTRGDGTGGESIYGKKFNDENFKIKHSKPGLLSMANAGPNTNGSQFFIT 148
BLAST of DY271120 vs. ExPASy Swiss-Prot
Match: CYPH_SCHPO (Peptidyl-prolyl cis-trans isomerase OS=Schizosaccharomyces pombe GN=ppi1 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 6.321e-11 Identity = 33/55 (60.00%), Postives = 42/55 (76.36%), Query Frame = -2 Query: 26 MAEGGDFVKRDGTSGESIYEGKFPDESPRLKHDRPGLLSMSIADRDTLGSQFIIT 190 M +GGDF + +GT G+SIY KFPDE+ LKH++PGLLSM+ A +T GSQF IT Sbjct: 59 MLQGGDFTRGNGTGGKSIYGEKFPDENFALKHNKPGLLSMANAGPNTNGSQFFIT 113
BLAST of DY271120 vs. ExPASy Swiss-Prot
Match: PPID_ASPFU (Peptidyl-prolyl cis-trans isomerase D OS=Aspergillus fumigatus GN=cpr6 PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 8.255e-11 Identity = 35/59 (59.32%), Postives = 41/59 (69.49%), Query Frame = -2 Query: 26 LKGSMAEGGDFVKRDGTSGESIYEGKFPDESPRLKHDRPGLLSMSIADRDTLGSQFIIT 202 +K M +GGDF +GT GESIY KFPDE+ LKHDRP LLSM+ + T GSQF IT Sbjct: 72 IKQFMIQGGDFTNFNGTGGESIYGEKFPDENFELKHDRPFLLSMANSGPGTNGSQFFIT 130 The following BLAST results are available for this feature:
BLAST of DY271120 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 23
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DY271120 ID=DY271120; Name=DY271120; organism=Citrus clementina; type=EST; length=1163bpback to top |