EH406307
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EH406307 vs. ExPASy Swiss-Prot
Match: SUT3_STYHA (Low affinity sulfate transporter 3 OS=Stylosanthes hamata GN=ST3 PE=2 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 9.563e-11 Identity = 27/72 (37.50%), Postives = 47/72 (65.28%), Query Frame = 1 Query: 175 VILEMAPVTYIDSSAVQALKDLYQEYKSRDIQIAISNPNHEVLLTLSKSGVVDLIGKEWYFVRAHDAVQVCL 390 +I++M +T +D+S + AL++L+++ SR +++A+ NP EV+ L + VD IGKE F+ +AV CL Sbjct: 565 IIIDMTDLTNVDTSGILALEELHKKLLSRGVELAMVNPRWEVIHKLKVANFVDKIGKERVFLTVAEAVDACL 636 HSP 2 Score: 27.335 bits (59), Expect = 9.563e-11 Identity = 13/30 (43.33%), Postives = 20/30 (66.67%), Query Frame = 3 Query: 12 QYPEAYTYHGIVIVRIDA-PIYFANISFLK 98 QYP A T GI+++RI + + FAN F++ Sbjct: 510 QYPMAVTTPGILVIRISSGSLCFANAGFVR 539 The following BLAST results are available for this feature:
BLAST of EH406307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 11
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EH406307 ID=EH406307; Name=EH406307; organism=Citrus clementina; type=EST; length=762bpback to top |