FC868498

Overview
NameFC868498
Unique NameFC868498
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length728
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:1..729. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A2_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 383.259 bits (983), Expect = 7.387e-106
Identity = 191/215 (88.84%), Postives = 199/215 (92.56%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD*E-VYHLDWYRGPT 725
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK+R++EIVKEVSSYLKKVGY P K    PISG    +  +   +LDWY+GPT
Sbjct:    1 MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRFEEIVKEVSSYLKKVGYNPDKIAFIPISGFEGDNMIDRSTNLDWYKGPT 215          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A2_HORVU (Elongation factor 1-alpha OS=Hordeum vulgare GN=BLT63 PE=1 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 8.167e-105
Identity = 191/215 (88.84%), Postives = 196/215 (91.16%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD*E-VYHLDWYRGPT 725
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIE FEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKY CTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVK MICCCNKMDATTPKYSK+RYDEIVKEVSSYLKKVGY P K    PISG    +  E   +LDWY+GPT
Sbjct:    1 MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIESFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYSCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKHMICCCNKMDATTPKYSKSRYDEIVKEVSSYLKKVGYNPDKVPFVPISGFEGDNMIERSSNLDWYKGPT 215          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A1_HORVU (Elongation factor 1-alpha OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 1.067e-104
Identity = 191/215 (88.84%), Postives = 197/215 (91.63%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD*E-VYHLDWYRGPT 725
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKY CTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTG F+AGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK+RYDEIVKEVSSYLKKVGY P K    PISG    +  E   +LDWY+GPT
Sbjct:    1 MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYSCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGVFQAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYDEIVKEVSSYLKKVGYNPDKVPFVPISGFEGDNMIERSSNLDWYKGPT 215          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_PEA (Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 2.459e-101
Identity = 186/215 (86.51%), Postives = 194/215 (90.23%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD*E-VYHLDWYRGPT 725
            MGKEK HINIVVIGHVDSGKSTTT H+IYKLGGIDKRVIERFEKEA EMNKRSFKYAW+LDKLKAERERGITIDIAL KFETTKYY TV+DAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK RY+EIVKEVSSYLK+VGY P K    PISG    +  E   +LDWY+GPT
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTVHVIYKLGGIDKRVIERFEKEADEMNKRSFKYAWLLDKLKAERERGITIDIALLKFETTKYYSTVMDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYEEIVKEVSSYLKEVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPT 215          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_DICDI (Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a1 PE=1 SV=2)

HSP 1 Score: 333.183 bits (853), Expect = 8.766e-91
Identity = 165/215 (76.74%), Postives = 186/215 (86.51%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD*E-VYHLDWYRGPT 725
            MGKEKTHINIVVIGHVD+GKSTTTGHLIYK GGIDKRVIE++EKEA+EM K+SFKYAWV+DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVL+I S TG FEAGI+K+GQTREHALLA+TLGVKQMI   NKMD  +  YS+ARYDEIVKEVSS++KK+GY P K    PISG    +  E    ++WY+GPT
Sbjct:    1 MGKEKTHINIVVIGHVDAGKSTTTGHLIYKCGGIDKRVIEKYEKEASEMGKQSFKYAWVMDKLKAERERGITIDIALWKFETSKYYFTIIDAPGHRDFIKNMITGTSQADCAVLVIASPTGEFEAGIAKNGQTREHALLAYTLGVKQMIVAINKMDEKSTNYSQARYDEIVKEVSSFIKKIGYNPEKVAFVPISGWNGDNMLERSDKMEWYKGPT 215          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A2_RAT (Elongation factor 1-alpha 2 OS=Rattus norvegicus GN=Eef1a2 PE=2 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 1.828e-88
Identity = 160/195 (82.05%), Postives = 173/195 (88.72%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFETTKYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RYDEIVKEVS+Y+KK+GY P      PISG
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISG 195          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A2_RABIT (Elongation factor 1-alpha 2 OS=Oryctolagus cuniculus GN=EEF1A2 PE=1 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 1.828e-88
Identity = 160/195 (82.05%), Postives = 173/195 (88.72%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFETTKYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RYDEIVKEVS+Y+KK+GY P      PISG
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISG 195          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A2_MOUSE (Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef1a2 PE=1 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 1.828e-88
Identity = 160/195 (82.05%), Postives = 173/195 (88.72%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFETTKYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RYDEIVKEVS+Y+KK+GY P      PISG
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISG 195          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A2_HUMAN (Elongation factor 1-alpha 2 OS=Homo sapiens GN=EEF1A2 PE=1 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 1.828e-88
Identity = 160/195 (82.05%), Postives = 173/195 (88.72%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFETTKYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RYDEIVKEVS+Y+KK+GY P      PISG
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISG 195          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A2_BOVIN (Elongation factor 1-alpha 2 OS=Bos taurus GN=EEF1A2 PE=2 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 1.828e-88
Identity = 160/195 (82.05%), Postives = 173/195 (88.72%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFETTKYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RYDEIVKEVS+Y+KK+GY P      PISG
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISG 195          
The following BLAST results are available for this feature:
BLAST of FC868498 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A2_DAUCA7.387e-10688.84Elongation factor 1-alpha OS=Daucus carota PE=2 SV... [more]
EF1A2_HORVU8.167e-10588.84Elongation factor 1-alpha OS=Hordeum vulgare GN=BL... [more]
EF1A1_HORVU1.067e-10488.84Elongation factor 1-alpha OS=Hordeum vulgare PE=1 ... [more]
EF1A_PEA2.459e-10186.51Elongation factor 1-alpha OS=Pisum sativum PE=2 SV... [more]
EF1A_DICDI8.766e-9176.74Elongation factor 1-alpha OS=Dictyostelium discoid... [more]
EF1A2_RAT1.828e-8882.05Elongation factor 1-alpha 2 OS=Rattus norvegicus G... [more]
EF1A2_RABIT1.828e-8882.05Elongation factor 1-alpha 2 OS=Oryctolagus cunicul... [more]
EF1A2_MOUSE1.828e-8882.05Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef... [more]
EF1A2_HUMAN1.828e-8882.05Elongation factor 1-alpha 2 OS=Homo sapiens GN=EEF... [more]
EF1A2_BOVIN1.828e-8882.05Elongation factor 1-alpha 2 OS=Bos taurus GN=EEF1A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001B02EF AbioticL1 Citrus clementina cDNA clone C31001B02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868498 ID=FC868498|Name=FC868498|organism=Citrus clementina|type=EST|length=728bp
GACTCTTTGCCCTCCCTCTTTTCTTGCTTGCTCTGCGGCTAGGTTTCAAT
TGTCTCTTCGAAGTTTCAGTTAATTTAACAGCCATGGGTAAGGAGAAGAC
TCACATCAACATTGTGGTGATTGGCCATGTCGACTCTGGAAAGTCGACCA
CCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATC
GAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACACCCCGAGAAAGTCCCAT
TCGTGCCCNATCTCTGGTTCGAGGGTGACACATGATTGAGAGGTCTACCA
CCTTGACTGGTACAGGGGTCCAACCTGC
back to top