FC868498

Overview
NameFC868498
Unique NameFC868498
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length728
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:1..729. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A1_HUMAN (Elongation factor 1-alpha 1 OS=Homo sapiens GN=EEF1A1 PE=1 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 2.021e-87
Identity = 158/195 (81.03%), Postives = 173/195 (88.72%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GY P      PISG
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISG 195          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A1_HORSE (Elongation factor 1-alpha 1 OS=Equus caballus GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 2.021e-87
Identity = 158/195 (81.03%), Postives = 173/195 (88.72%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GY P      PISG
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISG 195          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A1_FELCA (Elongation factor 1-alpha 1 OS=Felis catus GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 2.021e-87
Identity = 158/195 (81.03%), Postives = 173/195 (88.72%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GY P      PISG
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISG 195          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A1_CRIGR (Elongation factor 1-alpha 1 OS=Cricetulus griseus GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 2.021e-87
Identity = 158/195 (81.03%), Postives = 173/195 (88.72%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GY P      PISG
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISG 195          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A1_BOVIN (Elongation factor 1-alpha 1 OS=Bos taurus GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 2.021e-87
Identity = 158/195 (81.03%), Postives = 173/195 (88.72%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GY P      PISG
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISG 195          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A0_XENLA (Elongation factor 1-alpha, somatic form OS=Xenopus laevis GN=eef1as PE=2 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 2.021e-87
Identity = 158/195 (81.03%), Postives = 173/195 (88.72%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GY P      PISG
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISG 195          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_EUGGR (Elongation factor 1-alpha OS=Euglena gracilis GN=TEF PE=2 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 2.639e-87
Identity = 165/215 (76.74%), Postives = 178/215 (82.79%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD*EV-YHLDWYRGPT 725
            MGKEK HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA+EM K SFKYAWVLDKLKAERER ITIDIALWKFET K   T+IDAPGHRDFIKNMITGTSQAD AVL+IDSTTGGFEAGISKDGQTREHALLA+TLGVKQMI   NK D  T KYS+ARY+EI KEVS YLKKVGY P K    PISG    +  E   ++ WY+G T
Sbjct:    1 MGKEKVHISLVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEASEMGKGSFKYAWVLDKLKAERERCITIDIALWKFETAKSVFTIIDAPGHRDFIKNMITGTSQADAAVLVIDSTTGGFEAGISKDGQTREHALLAYTLGVKQMIVATNKFDDKTVKYSQARYEEIKKEVSGYLKKVGYNPEKVPFIPISGWNGDNMIEASENMGWYKGLT 215          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A1_DROME (Elongation factor 1-alpha 1 OS=Drosophila melanogaster GN=Ef1alpha48D PE=1 SV=2)

HSP 1 Score: 321.242 bits (822), Expect = 3.447e-87
Identity = 159/195 (81.54%), Postives = 171/195 (87.69%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD++ P YS+ARY+EI KEVSSY+KK+GY P      PISG
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISG 195          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_ORYLA (Elongation factor 1-alpha OS=Oryzias latipes GN=eef1a PE=2 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 1.310e-86
Identity = 160/213 (75.12%), Postives = 179/213 (84.04%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD*EVY-HLDWYRG 719
            MGKEK HINIVVIGHVDSGKST+TGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVLDKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS+AR++EI KEVS+Y+KK+GY P      PISG    +  E    + W++G
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEIQKEVSTYIKKIGYNPAAVAFVPISGWHGDNMLEASDKMSWFKG 213          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_CAEEL (Elongation factor 1-alpha OS=Caenorhabditis elegans GN=eft-3 PE=2 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 1.711e-86
Identity = 158/213 (74.18%), Postives = 177/213 (83.10%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD*EV-YHLDWYRG 719
            MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVL++   TG FEAGISK+GQTREHALLA TLGVKQ+I  CNKMD+T P +S+AR+ EI  EVS ++KK+GY P+     PISG    +  EV  ++ W++G
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNMPWFKG 213          
The following BLAST results are available for this feature:
BLAST of FC868498 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A1_HUMAN2.021e-8781.03Elongation factor 1-alpha 1 OS=Homo sapiens GN=EEF... [more]
EF1A1_HORSE2.021e-8781.03Elongation factor 1-alpha 1 OS=Equus caballus GN=E... [more]
EF1A1_FELCA2.021e-8781.03Elongation factor 1-alpha 1 OS=Felis catus GN=EEF1... [more]
EF1A1_CRIGR2.021e-8781.03Elongation factor 1-alpha 1 OS=Cricetulus griseus ... [more]
EF1A1_BOVIN2.021e-8781.03Elongation factor 1-alpha 1 OS=Bos taurus GN=EEF1A... [more]
EF1A0_XENLA2.021e-8781.03Elongation factor 1-alpha, somatic form OS=Xenopus... [more]
EF1A_EUGGR2.639e-8776.74Elongation factor 1-alpha OS=Euglena gracilis GN=T... [more]
EF1A1_DROME3.447e-8781.54Elongation factor 1-alpha 1 OS=Drosophila melanoga... [more]
EF1A_ORYLA1.310e-8675.12Elongation factor 1-alpha OS=Oryzias latipes GN=ee... [more]
EF1A_CAEEL1.711e-8674.18Elongation factor 1-alpha OS=Caenorhabditis elegan... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001B02EF AbioticL1 Citrus clementina cDNA clone C31001B02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868498 ID=FC868498|Name=FC868498|organism=Citrus clementina|type=EST|length=728bp
GACTCTTTGCCCTCCCTCTTTTCTTGCTTGCTCTGCGGCTAGGTTTCAAT
TGTCTCTTCGAAGTTTCAGTTAATTTAACAGCCATGGGTAAGGAGAAGAC
TCACATCAACATTGTGGTGATTGGCCATGTCGACTCTGGAAAGTCGACCA
CCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATC
GAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACACCCCGAGAAAGTCCCAT
TCGTGCCCNATCTCTGGTTCGAGGGTGACACATGATTGAGAGGTCTACCA
CCTTGACTGGTACAGGGGTCCAACCTGC
back to top