FC868498

Overview
NameFC868498
Unique NameFC868498
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length728
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:1..729. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_APIME (Elongation factor 1-alpha OS=Apis mellifera PE=3 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 1.892e-85
Identity = 157/195 (80.51%), Postives = 168/195 (86.15%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD T P YS+AR++EI KEVSSY+KK+GY        PISG
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGIGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDMTDPPYSEARFEEIKKEVSSYIKKIGYNTASVAFVPISG 195          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_PODCU (Elongation factor 1-alpha OS=Podospora curvicolla GN=TEF PE=3 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 4.214e-85
Identity = 161/214 (75.23%), Postives = 180/214 (84.11%), Query Frame = 3
Query:   84 MGKE-KTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD*EV-YHLDWYRG 719
            MGKE KTHIN+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD T  K+S+AR++EI+KE S+++KKVGY P+     PISG    +  E   +  WY+G
Sbjct:    1 MGKEDKTHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEARFNEIIKETSNFIKKVGYNPKTVAFVPISGFNGDNMLEASTNCPWYKG 212          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_PODAN (Elongation factor 1-alpha OS=Podospora anserina GN=TEF PE=3 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 4.214e-85
Identity = 161/214 (75.23%), Postives = 180/214 (84.11%), Query Frame = 3
Query:   84 MGKE-KTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD*EV-YHLDWYRG 719
            MGKE KTHIN+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD T  K+S+AR++EI+KE S+++KKVGY P+     PISG    +  E   +  WY+G
Sbjct:    1 MGKEDKTHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEARFNEIIKETSNFIKKVGYNPKTVAFVPISGFNGDNMLEASTNCPWYKG 212          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A2_XENLA (Elongation factor 1-alpha, oocyte form OS=Xenopus laevis GN=eef1ao PE=1 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 4.214e-85
Identity = 157/213 (73.71%), Postives = 177/213 (83.10%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD*EV-YHLDWYRG 719
            MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET K+Y T+IDAPGHRDFIKNMITGTSQADCAVLI+    G FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P +S+ R++EI KEVS+Y+KK+GY P      PISG    +  E   ++ W++G
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETGKFYITIIDAPGHRDFIKNMITGTSQADCAVLIVAGGVGEFEAGISKNGQTREHALLAFTLGVKQLIIGVNKMDSTEPPFSQKRFEEITKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEASTNMPWFKG 213          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_ABSGL (Elongation factor 1-alpha OS=Absidia glauca GN=TEF-1 PE=3 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 9.388e-85
Identity = 156/213 (73.24%), Postives = 180/213 (84.51%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD-*EVYHLDWYRG 719
            MGKEKTH+N+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY+ TVIDAPGHRDFIKNMITGTSQADC +LII + TG FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD+T  K+S+ R++EI+KEVS ++KK+G+ P+     PISG    +   E  ++ WY+G
Sbjct:    1 MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCGILIIAAGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDST--KWSEQRFNEIIKEVSGFIKKIGFNPKSVPFVPISGWHGDNMLEESTNMPWYKG 211          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_HYDAT (Elongation factor 1-alpha OS=Hydra attenuata PE=2 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 1.601e-84
Identity = 157/211 (74.41%), Postives = 177/211 (83.89%), Query Frame = 3
Query:   90 KEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD*EVY-HLDWYRG 719
            K K HINIVVIGHVDSGKST+TGH+IYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFETTKY  T+IDAPGHRDFIKNMITGTSQADCAVLI+ S+TG FEAGISK+GQTREHALLAFTLGVKQMI   NK+D T P YS+AR++EI KE+S+Y+KKVGY P+     P+SG    +  E   ++ WY+G
Sbjct:    4 KVKPHINIVVIGHVDSGKSTSTGHMIYKCGGIDKRQIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKYVVTIIDAPGHRDFIKNMITGTSQADCAVLIVASSTGEFEAGISKNGQTREHALLAFTLGVKQMIVAVNKIDNTEPPYSEARFNEIKKEISAYVKKVGYDPKTVPVLPVSGWHGDNMIEPSPNMSWYKG 214          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A3_RHIRA (Elongation factor 1-alpha OS=Rhizomucor racemosus GN=TEF-3 PE=3 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 1.601e-84
Identity = 155/195 (79.49%), Postives = 170/195 (87.18%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            MGKEKTH+N+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII   TG FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD T  K+S+ RY+EIVKEVS ++KK+G+ P+     PISG
Sbjct:    1 MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDTT--KWSQDRYNEIVKEVSGFIKKIGFNPKSVPFVPISG 193          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_CANAL (Elongation factor 1-alpha OS=Candida albicans GN=TEF1 PE=1 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 3.567e-84
Identity = 157/213 (73.71%), Postives = 177/213 (83.10%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD*E-VYHLDWYRG 719
            MGKEKTH+N+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY+ TVIDAPGHRDFIKNMITGTSQADCA+LII   TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD+   K+ K R++EI+KE S+++KKVGY P+     PISG    +  E   +  WY+G
Sbjct:    1 MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAVNKMDSV--KWDKNRFEEIIKETSNFVKKVGYNPKTVPFVPISGWNGDNMIEPSTNCPWYKG 211          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_ASHGO (Elongation factor 1-alpha OS=Ashbya gossypii GN=TEF PE=3 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 3.567e-84
Identity = 157/213 (73.71%), Postives = 176/213 (82.63%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD*E-VYHLDWYRG 719
            MGKEKTH+N+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY+ TVIDAPGHRDFIKNMITGTSQADCA+LII    G FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD+   K+ ++RY EIVKE S+++KKVGY P+     PISG    +  E   +  WY+G
Sbjct:    1 MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDSV--KWDESRYQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKG 211          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_PICGU (Elongation factor 1-alpha OS=Pichia guilliermondii GN=TEF1 PE=3 SV=2)

HSP 1 Score: 310.842 bits (795), Expect = 4.659e-84
Identity = 156/213 (73.24%), Postives = 177/213 (83.10%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD*EV-YHLDWYRG 719
            MGKEKTH+N+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY+ TVIDAPGHRDFIKNMITGTSQADCA+LII   TG FEAGISKDGQTREHALLA+TLGV+Q+I   NKMD+   K+ K R++EI+KE S+++KKVGY P+     PISG    +  E   +  WY+G
Sbjct:    1 MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAYTLGVRQLIVAVNKMDSV--KWDKNRFEEIIKETSNFVKKVGYNPKTVPFVPISGWNGDNMIEASTNCPWYKG 211          
The following BLAST results are available for this feature:
BLAST of FC868498 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_APIME1.892e-8580.51Elongation factor 1-alpha OS=Apis mellifera PE=3 S... [more]
EF1A_PODCU4.214e-8575.23Elongation factor 1-alpha OS=Podospora curvicolla ... [more]
EF1A_PODAN4.214e-8575.23Elongation factor 1-alpha OS=Podospora anserina GN... [more]
EF1A2_XENLA4.214e-8573.71Elongation factor 1-alpha, oocyte form OS=Xenopus ... [more]
EF1A_ABSGL9.388e-8573.24Elongation factor 1-alpha OS=Absidia glauca GN=TEF... [more]
EF1A_HYDAT1.601e-8474.41Elongation factor 1-alpha OS=Hydra attenuata PE=2 ... [more]
EF1A3_RHIRA1.601e-8479.49Elongation factor 1-alpha OS=Rhizomucor racemosus ... [more]
EF1A_CANAL3.567e-8473.71Elongation factor 1-alpha OS=Candida albicans GN=T... [more]
EF1A_ASHGO3.567e-8473.71Elongation factor 1-alpha OS=Ashbya gossypii GN=TE... [more]
EF1A_PICGU4.659e-8473.24Elongation factor 1-alpha OS=Pichia guilliermondii... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001B02EF AbioticL1 Citrus clementina cDNA clone C31001B02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868498 ID=FC868498|Name=FC868498|organism=Citrus clementina|type=EST|length=728bp
GACTCTTTGCCCTCCCTCTTTTCTTGCTTGCTCTGCGGCTAGGTTTCAAT
TGTCTCTTCGAAGTTTCAGTTAATTTAACAGCCATGGGTAAGGAGAAGAC
TCACATCAACATTGTGGTGATTGGCCATGTCGACTCTGGAAAGTCGACCA
CCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATC
GAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACACCCCGAGAAAGTCCCAT
TCGTGCCCNATCTCTGGTTCGAGGGTGACACATGATTGAGAGGTCTACCA
CCTTGACTGGTACAGGGGTCCAACCTGC
back to top