FC868615
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC868615 vs. ExPASy Swiss-Prot
Match: SECY_PYRHO (Preprotein translocase subunit secY OS=Pyrococcus horikoshii GN=secY PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 6.971e-11 Identity = 44/123 (35.77%), Postives = 70/123 (56.91%), Query Frame = 2 Query: 110 GALREAFYRQ-NLPNITNLLATVLVFLIVVYFQGFKVVLPVRSKNARGQQGAYPIKLFYTSNMPIILQSALVSNLYFISQLLYRKYSGNFFVNLLGKWKESEYSGHSIPVGGLAYYVTAPSKL 475 G L+ A YR + P++ + AT++VFL+VVYF+ +V +P+ + +G YPIK Y SN+PIIL AL +N+ +++L R F LG++ +G+ P+GG YV P + Sbjct: 226 GDLKGALYRGGSAPDMIAVTATIIVFLVVVYFESMRVEIPLGYRGVT-IRGRYPIKFLYVSNIPIILTFALYANIQLWARVLDR-----FGHPWLGRF--DPVTGN--PIGGFVLYVIPPRNI 338 HSP 2 Score: 21.1718 bits (43), Expect = 6.971e-11 Identity = 9/31 (29.03%), Postives = 15/31 (48.39%), Query Frame = 3 Query: 465 PASLADMAANPFHALFYLVFMLTACALFSKL 557 P ++ + NP A+ YL+ + LF L Sbjct: 335 PRNIFTVIDNPVRAIIYLILTIIFSLLFGFL 365 The following BLAST results are available for this feature:
BLAST of FC868615 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 41
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC868615 ID=FC868615; Name=FC868615; organism=Citrus clementina; type=EST; length=587bpback to top |