FC868656

Overview
NameFC868656
Unique NameFC868656
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length710
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868656 vs. ExPASy Swiss-Prot
Match: HSP7C_HORSE (Heat shock cognate 71 kDa protein OS=Equus caballus GN=HSPA8 PE=2 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 4.948e-99
Identity = 185/236 (78.39%), Postives = 203/236 (86.02%), Query Frame = 3
Query:    3 TVFDAKSLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYXGIDFLLTIT 710
            TVFDAK LIGRRF DA VQ DMK WPF V+   A +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKK  +  E+NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHF+ EFKRK+KKDIS N RA+RRLRTACERAKRTLSS+ Q +IEIDSLY GIDF  +IT
Sbjct:   66 TVFDAKRLIGRRFDDAVVQSDMKHWPFMVV-NDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGA--ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSIT 298          
BLAST of FC868656 vs. ExPASy Swiss-Prot
Match: HSP7C_BOVIN (Heat shock cognate 71 kDa protein OS=Bos taurus GN=HSPA8 PE=1 SV=2)

HSP 1 Score: 360.533 bits (924), Expect = 4.948e-99
Identity = 185/236 (78.39%), Postives = 203/236 (86.02%), Query Frame = 3
Query:    3 TVFDAKSLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYXGIDFLLTIT 710
            TVFDAK LIGRRF DA VQ DMK WPF V+   A +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKK  +  E+NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHF+ EFKRK+KKDIS N RA+RRLRTACERAKRTLSS+ Q +IEIDSLY GIDF  +IT
Sbjct:   66 TVFDAKRLIGRRFDDAVVQSDMKHWPFMVV-NDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGA--ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSIT 298          
BLAST of FC868656 vs. ExPASy Swiss-Prot
Match: HS71B_MOUSE (Heat shock 70 kDa protein 1B OS=Mus musculus GN=Hspa1b PE=1 SV=3)

HSP 1 Score: 359.762 bits (922), Expect = 8.439e-99
Identity = 182/236 (77.12%), Postives = 206/236 (87.29%), Query Frame = 3
Query:    3 TVFDAKSLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYXGIDFLLTIT 710
            TVFDAK LIGR+F DA VQ DMK WPF+V+    DKP + VNYKGE + F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLD+  T  GE+NVLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNR+V+HFV+EFKRK+KKDIS N RA+RRLRTACERAKRTLSS+ Q ++EIDSL+ GIDF  +IT
Sbjct:   66 TVFDAKRLIGRKFGDAVVQSDMKHWPFQVV-NDGDKPKVQVNYKGESRSFFPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDR--TGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSIT 298          
BLAST of FC868656 vs. ExPASy Swiss-Prot
Match: HS71A_MOUSE (Heat shock 70 kDa protein 1A OS=Mus musculus GN=Hspa1a PE=1 SV=2)

HSP 1 Score: 359.762 bits (922), Expect = 8.439e-99
Identity = 182/236 (77.12%), Postives = 206/236 (87.29%), Query Frame = 3
Query:    3 TVFDAKSLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYXGIDFLLTIT 710
            TVFDAK LIGR+F DA VQ DMK WPF+V+    DKP + VNYKGE + F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLD+  T  GE+NVLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNR+V+HFV+EFKRK+KKDIS N RA+RRLRTACERAKRTLSS+ Q ++EIDSL+ GIDF  +IT
Sbjct:   66 TVFDAKRLIGRKFGDAVVQSDMKHWPFQVV-NDGDKPKVQVNYKGESRSFFPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDR--TGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSIT 298          
BLAST of FC868656 vs. ExPASy Swiss-Prot
Match: HSP70_ONCTS (Heat shock 70 kDa protein OS=Oncorhynchus tschawytscha GN=hsp70 PE=2 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 1.102e-98
Identity = 183/236 (77.54%), Postives = 207/236 (87.71%), Query Frame = 3
Query:    3 TVFDAKSLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYXGIDFLLTIT 710
            TVFDAK LIGR+F+D  VQ DMK WPFKV++    KP + V+YKGE K F  EEISSMVL+KMREIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYG+DK  +   E+NVLIFDLGGGTFDVS+LTIE+GIFEVKATAGDTHLGGEDFDNR+V+HFV+EFKRK+KKDIS N RALRRLRTACERAKRTLSS++Q +IEIDSL+ GIDF  +IT
Sbjct:   68 TVFDAKRLIGRKFNDQVVQADMKHWPFKVVSD-GGKPKVQVDYKGENKSFNPEEISSMVLVKMREIAEAYLGQKVSNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGMDKGMSR--ERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTSIT 300          
BLAST of FC868656 vs. ExPASy Swiss-Prot
Match: HS71B_PIG (Heat shock 70 kDa protein 1B OS=Sus scrofa GN=HSPA1B PE=2 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 1.102e-98
Identity = 183/236 (77.54%), Postives = 205/236 (86.86%), Query Frame = 3
Query:    3 TVFDAKSLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYXGIDFLLTIT 710
            TVFDAK LIGR+F D  VQ DMK WPF+VI    DKP + V+YKGE K F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLD+  T  GE+NVLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNR+VNHFV+EFKRK+KKDIS N RA+RRLRTACERAKRTLSS+ Q ++EIDSL+ GIDF  +IT
Sbjct:   66 TVFDAKRLIGRKFGDPVVQADMKHWPFRVI-NDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGHPVSNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDR--TGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSIT 298          
BLAST of FC868656 vs. ExPASy Swiss-Prot
Match: HSP7A_DROME (Heat shock 70 kDa protein cognate 1 OS=Drosophila melanogaster GN=Hsc70-1 PE=1 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.440e-98
Identity = 183/236 (77.54%), Postives = 204/236 (86.44%), Query Frame = 3
Query:    3 TVFDAKSLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYXGIDFLLTIT 710
            T+FDAK LIGRRF DA+VQ DMK WPF+V A    KP I V YKGE K F  EE+SSMVL KMRE AEAYLG T+ +AVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDK+ TS  E+NVLIFDLGGGTFDVS+LTIE+GIFEVKATAGDTHLGGEDFDNR+VNHFVQEF+RK+KKD+  N RALRRLRTACERAKRTLSS+ Q +IEIDSL+ G+DF  ++T
Sbjct:   66 TIFDAKRLIGRRFDDATVQSDMKHWPFEVFAENG-KPRIRVEYKGERKSFYPEEVSSMVLTKMRETAEAYLGGTVTDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQGTS--ERNVLIFDLGGGTFDVSVLTIEDGIFEVKATAGDTHLGGEDFDNRLVNHFVQEFQRKHKKDLGQNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSVT 298          
BLAST of FC868656 vs. ExPASy Swiss-Prot
Match: HSP70_ONCMY (Heat shock cognate 70 kDa protein OS=Oncorhynchus mykiss GN=hsc71 PE=2 SV=2)

HSP 1 Score: 358.992 bits (920), Expect = 1.440e-98
Identity = 184/236 (77.97%), Postives = 203/236 (86.02%), Query Frame = 3
Query:    3 TVFDAKSLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYXGIDFLLTIT 710
            TVFDAK LIGRRF D  VQ DMK WPF+VI   + +P + V YKGE K F  EEISSMVL+KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYGLDKK  +  E+NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHF+ EFKRK KKDIS N RA+RRLRTACERAKRTLSS+ Q +IEIDSLY GIDF  +IT
Sbjct:   66 TVFDAKRLIGRRFDDGVVQSDMKHWPFEVI-NDSTRPKLQVEYKGETKSFYPEEISSMVLVKMKEIAEAYLGKTVNNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGA--ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSIT 298          
BLAST of FC868656 vs. ExPASy Swiss-Prot
Match: HSP70_CHLRE (Heat shock 70 kDa protein OS=Chlamydomonas reinhardtii GN=HSP70 PE=2 SV=2)

HSP 1 Score: 358.992 bits (920), Expect = 1.440e-98
Identity = 184/238 (77.31%), Postives = 206/238 (86.55%), Query Frame = 3
Query:    3 TVFDAKSLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGST--IKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYXGIDFLLTIT 710
            TVFDAK LIGR+FSD  VQ D+KLWPF+V AG  D P I V+YK EEK F AEEISSMVLIKM+E A+A LG+   +K AVVTVPAYFNDSQRQATKDAG+IAGL V+RIINEPTAAAI+YGLDKK + +GE+NVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD R+VNHF  EF+RK KKD+  +PRALRRLRTACERAKRTLSS AQTTIE+DSL+ G+DF  +IT
Sbjct:   67 TVFDAKRLIGRKFSDPIVQADIKLWPFQVRAGAHDVPEIVVSYKNEEKVFKAEEISSMVLIKMKETAQASLGADREVKKAVVTVPAYFNDSQRQATKDAGMIAGLEVLRIINEPTAAAISYGLDKKDSGLGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDERLVNHFANEFQRKYKKDLKTSPRALRRLRTACERAKRTLSSAAQTTIELDSLFEGVDFATSIT 304          
BLAST of FC868656 vs. ExPASy Swiss-Prot
Match: HSP70_ACHKL (Heat shock 70 kDa protein OS=Achlya klebsiana GN=HSP70 PE=2 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.440e-98
Identity = 181/236 (76.69%), Postives = 203/236 (86.02%), Query Frame = 3
Query:    3 TVFDAKSLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYXGIDFLLTIT 710
            TVFDAK LIGR+F+D + Q D+K WPFKV  G  DKP I V +KGE K F  EEISSMVLIKM+E+AEA++G+ + NAV+TVPAYFNDSQRQATKDAG IAGLNV+RIINEPT AAIAYGLDKK    GE+NVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR+V+HF  EFKRK++KD++ N RALRRLRTACERAKRTLSS+AQ  IEIDSL+ GIDF  TIT
Sbjct:   68 TVFDAKRLIGRKFNDPATQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSMVLIKMKEVAEAFIGTAVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTRAAIAYGLDKKG---GERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTAEFKRKHRKDMTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT 300          
The following BLAST results are available for this feature:
BLAST of FC868656 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP7C_HORSE4.948e-9978.39Heat shock cognate 71 kDa protein OS=Equus caballu... [more]
HSP7C_BOVIN4.948e-9978.39Heat shock cognate 71 kDa protein OS=Bos taurus GN... [more]
HS71B_MOUSE8.439e-9977.12Heat shock 70 kDa protein 1B OS=Mus musculus GN=Hs... [more]
HS71A_MOUSE8.439e-9977.12Heat shock 70 kDa protein 1A OS=Mus musculus GN=Hs... [more]
HSP70_ONCTS1.102e-9877.54Heat shock 70 kDa protein OS=Oncorhynchus tschawyt... [more]
HS71B_PIG1.102e-9877.54Heat shock 70 kDa protein 1B OS=Sus scrofa GN=HSPA... [more]
HSP7A_DROME1.440e-9877.54Heat shock 70 kDa protein cognate 1 OS=Drosophila ... [more]
HSP70_ONCMY1.440e-9877.97Heat shock cognate 70 kDa protein OS=Oncorhynchus ... [more]
HSP70_CHLRE1.440e-9877.31Heat shock 70 kDa protein OS=Chlamydomonas reinhar... [more]
HSP70_ACHKL1.440e-9876.69Heat shock 70 kDa protein OS=Achlya klebsiana GN=H... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31003B06EF AbioticL1 Citrus clementina cDNA clone C31003B06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868656 ID=FC868656; Name=FC868656; organism=Citrus clementina; type=EST; length=710bp
ACACCGTCTTTGATGCAAAGAGCTTGATTGGTAGGAGATTCAGCGATGCA
TCAGTCCAAGGAGATATGAAGCTATGGCCATTTAAGGTGATTGCTGGACC
AGCTGACAAGCCCATGATTGGTGTTAACTACAAGGGCGAAGAGAAGCAGT
TTGCTGCTGAGGAAATCTCGTCTATGGTGCTCATCAAGATGCGTGAGATT
GCCGAGGCTTACCTTGGCTCAACTATTAAGAATGCAGTCGTTACTGTCCC
TGCTTACTTCAATGACTCACAGAGGCAGGCCACCAAGGATGCTGGTGTCA
TTGCTGGGCTTAATGTGATGCGTATCATCAATGAGCCCACTGCTGCTGCC
ATTGCTTATGGCCTTGACAAGAAGGCTACTAGTGTGGGTGAGAAGAATGT
GTTGATCTTTGATTTGGGTGGTGGTACTTTTGATGTGTCGTTGCTCACTA
TTGAGGAGGGAATCTTTGAAGTGAAGGCTACTGCTGGAGACACTCATCTT
GGTGGTGAGGATTTTGATAACAGAATGGTGAATCATTTTGTTCAGGAGTT
TAAGAGGAAGAACAAGAAGGATATTAGTGGCAACCCTAGAGCTCTTAGGA
GATTGAGGACTGCTTGTGAGAGAGCGAAGAGGACTCTCTCCTCTACTGCC
CAGACTACAATTGAGATTGATTCTTTGTATGANGGTATTGACTTTCTACT
CACCATAACT
back to top