FC868754

Overview
NameFC868754
Unique NameFC868754
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length729
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14114 contig Ccv1_Contig14114:20..750. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF_CICAR (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Cicer arietinum GN=ALDC PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 9.752e-44
Identity = 89/142 (62.68%), Postives = 105/142 (73.94%), Query Frame = 2
Query:  236 YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            Y DEL+  A  + +PG+GILA DES  T GKRLASI +EN E NR+A R LL TAP + QY+SG ILFEETLYQST  GK  VDVL E  ++PGIKVDKG V LAG++ E+  QGLDGL +R A YY+ GARFAKWR V+ I
Sbjct:    8 YHDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLFTAPNVLQYLSGVILFEETLYQSTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCAKYYEAGARFAKWRAVLKI 149          

HSP 2 Score: 21.557 bits (44), Expect = 9.752e-44
Identity = 10/14 (71.43%), Postives = 11/14 (78.57%), Query Frame = 3
Query:  684 SQEAAWGLARYAAI 725
            S E A+GLARYA I
Sbjct:  160 SIENAYGLARYAVI 173          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF_SPIOL (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.339e-43
Identity = 88/149 (59.06%), Postives = 104/149 (69.80%), Query Frame = 2
Query:  215 LTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            +T   G YADEL+  A  +A+PG+ ILA DES  T GKR  SI +EN E+NR+A R LL T PG   Y+SG ILFEETLYQ T DGK  VD + +  ++PGIKVDKG V LAG+N E+  QGLDGLA R A YY  GARFAKWR V+ I
Sbjct:    1 MTAYRGKYADELIANASYIATPGKVILAADESTGTIGKRFPSINVENVESNRRALRELLFTTPGALPYLSGVILFEETLYQKTADGKPFVDAMKDGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCAQYYTAGARFAKWRAVLKI 149          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF_MAIZE (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Zea mays PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 5.762e-42
Identity = 85/144 (59.03%), Postives = 101/144 (70.14%), Query Frame = 2
Query:  230 GSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            G Y DEL+K A  + +PG+GILA DES  T GKRL+SI +EN E NR+A R LL   PG  QYISG ILFEETLYQ T DGK  VDVL E  ++PGIKVDKG + + G++ E+  QG D L  R A YY+ GARFAKWR V+ I
Sbjct:    6 GKYKDELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLFCCPGALQYISGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVVGTDKETTTQGHDDLGKRCAKYYEAGARFAKWRAVLKI 149          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF_ORYSJ (Fructose-bisphosphate aldolase cytoplasmic isozyme OS=Oryza sativa subsp. japonica GN=FBA PE=1 SV=2)

HSP 1 Score: 169.859 bits (429), Expect = 1.284e-41
Identity = 84/144 (58.33%), Postives = 100/144 (69.44%), Query Frame = 2
Query:  230 GSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            G Y DEL+K A  + +PG+GILA DES  T GKR ASI +EN E NR++ R LL   PG  QY+SG ILFEETLYQ T DGK  VDVL E  ++PGIKVDKG + +AG+  E+  QG D L  R A YY+ GARFAKWR V+ I
Sbjct:    6 GKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLFCTPGALQYLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVAGTEKETTTQGHDDLGKRCAKYYEAGARFAKWRAVLKI 149          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF2_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 2 OS=Pisum sativum PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 8.320e-41
Identity = 87/143 (60.84%), Postives = 103/143 (72.03%), Query Frame = 2
Query:  236 YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLG-QYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            Y DEL+  A  + +PG+GILA DES  T GKRL+SI +EN E+NRQA R LL TA  L  QY+SG ILFEETLYQ T  GK  VDVL E  ++PGIKVDKG V LAG++ E+  QGLDGL +R   YY+ GARFAKWR V+ I
Sbjct:    8 YHDELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRQALRELLFTASWLFLQYLSGVILFEETLYQKTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCRKYYEAGARFAKWRAVLKI 150          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF_DICDI (Fructose-bisphosphate aldolase OS=Dictyostelium discoideum GN=fba PE=3 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 5.393e-40
Identity = 83/146 (56.85%), Postives = 103/146 (70.55%), Query Frame = 2
Query:  236 YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLV-TAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIPMA 670
            +ADEL+ TAK + +PG+GILA DES  T G R   I LEN E NR+AYR LL+ T  G+ ++I G IL+EETLYQ   DG+   DVL EQ I  GIKVDKG+VP+ G++ E+  QGLDGLA R   YY+ GARFAKWR V+ I +A
Sbjct:    5 FADELIATAKAIVAPGKGILAADESTNTIGARFKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQKMADGRLFTDVLREQKIHIGIKVDKGVVPIPGTDGETSTQGLDGLAERCKKYYEAGARFAKWRAVLKIDLA 150          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF_SCHMA (Fructose-bisphosphate aldolase OS=Schistosoma mansoni PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.017e-38
Identity = 83/147 (56.46%), Postives = 109/147 (74.15%), Query Frame = 2
Query:  242 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIPMAHLP 679
            ++L + A+ + +PG+GILA DES AT GKRL  IG+EN E NR+ YR LL +A   L + ISG ILFEETL+Q + DGK +  +L E+NI+PGIKVDKG+VPLAG+++E+  QGLD LASR A Y++ G RFAKWR V+ I  +H P
Sbjct:   14 NDLRRIAQAICAPGKGILAADESTATMGKRLQQIGVENNEENRRLYRQLLFSADHKLAENISGVILFEETLHQKSDDGKTLPTLLAERNIIPGIKVDKGVVPLAGTDNETTTQGLDDLASRCAEYWRLGCRFAKWRCVLKI-SSHTP 159          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF_PLAFA (Fructose-bisphosphate aldolase OS=Plasmodium falciparum PE=1 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.449e-38
Identity = 81/144 (56.25%), Postives = 100/144 (69.44%), Query Frame = 2
Query:  239 ADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIPMA 670
            A+EL  TA+ +   G+GILA DES  T  KR  +I LENT  NR +YR LL    GLG++ISGAILFEETL+Q    G  MV++L  +NI+PGIKVDKGLV +  +++E   QGLDGLA R   YY+ GARFAKWRTV+ I  A
Sbjct:   19 AEELATTAQKLVQAGKGILAADESTQTIKKRFDNIKLENTIENRASYRDLLFGTKGLGKFISGAILFEETLFQKNEAGVPMVNLLHNENIIPGIKVDKGLVNIPCTDEEKSTQGLDGLAERCKEYYKAGARFAKWRTVLVIDTA 162          

HSP 2 Score: 27.7202 bits (60), Expect = 1.449e-38
Identity = 12/19 (63.16%), Postives = 13/19 (68.42%), Query Frame = 3
Query:  669 PICLGSQEAAWGLARYAAI 725
            P  L   E AWGLARYA+I
Sbjct:  166 PTDLSIHETAWGLARYASI 184          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF_PLAF7 (Fructose-bisphosphate aldolase OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0425 PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.449e-38
Identity = 81/144 (56.25%), Postives = 100/144 (69.44%), Query Frame = 2
Query:  239 ADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIPMA 670
            A+EL  TA+ +   G+GILA DES  T  KR  +I LENT  NR +YR LL    GLG++ISGAILFEETL+Q    G  MV++L  +NI+PGIKVDKGLV +  +++E   QGLDGLA R   YY+ GARFAKWRTV+ I  A
Sbjct:   19 AEELATTAQKLVQAGKGILAADESTQTIKKRFDNIKLENTIENRASYRDLLFGTKGLGKFISGAILFEETLFQKNEAGVPMVNLLHNENIIPGIKVDKGLVNIPCTDEEKSTQGLDGLAERCKEYYKAGARFAKWRTVLVIDTA 162          

HSP 2 Score: 27.7202 bits (60), Expect = 1.449e-38
Identity = 12/19 (63.16%), Postives = 13/19 (68.42%), Query Frame = 3
Query:  669 PICLGSQEAAWGLARYAAI 725
            P  L   E AWGLARYA+I
Sbjct:  166 PTDLSIHETAWGLARYASI 184          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF2_PLABA (Fructose-bisphosphate aldolase 2 OS=Plasmodium berghei (strain Anka) GN=ALDO2 PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 2.461e-38
Identity = 79/144 (54.86%), Postives = 100/144 (69.44%), Query Frame = 2
Query:  239 ADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIPMA 670
            A EL +TAK + + G+GILA DES  T  KR  +I +ENT  NR +YR LL    GLG++ISGAILFEETL+Q    G  +V++L ++ I+PGIKVDKGLV +  ++DE   QGLDGLA R   YY+ GARFAKWR V+ I  A
Sbjct:    8 AQELAETAKKLVAAGKGILAADESTQTIKKRFDNIKIENTVQNRASYRDLLFGTKGLGKFISGAILFEETLFQKNEAGVPLVNLLHDEGIIPGIKVDKGLVSIPCTDDEKSTQGLDGLAERCKEYYKAGARFAKWRAVLVIDPA 151          

HSP 2 Score: 28.4906 bits (62), Expect = 2.461e-38
Identity = 12/19 (63.16%), Postives = 14/19 (73.68%), Query Frame = 3
Query:  669 PICLGSQEAAWGLARYAAI 725
            P  L  QE +WGLARYA+I
Sbjct:  155 PTDLSIQEVSWGLARYASI 173          
The following BLAST results are available for this feature:
BLAST of FC868754 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALF_CICAR9.752e-4462.68Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_SPIOL2.339e-4359.06Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_MAIZE5.762e-4259.03Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ORYSJ1.284e-4158.33Fructose-bisphosphate aldolase cytoplasmic isozyme... [more]
ALF2_PEA8.320e-4160.84Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_DICDI5.393e-4056.85Fructose-bisphosphate aldolase OS=Dictyostelium di... [more]
ALF_SCHMA1.017e-3856.46Fructose-bisphosphate aldolase OS=Schistosoma mans... [more]
ALF_PLAFA1.449e-3856.25Fructose-bisphosphate aldolase OS=Plasmodium falci... [more]
ALF_PLAF71.449e-3856.25Fructose-bisphosphate aldolase OS=Plasmodium falci... [more]
ALF2_PLABA2.461e-3854.86Fructose-bisphosphate aldolase 2 OS=Plasmodium ber... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31004D04EF AbioticL1 Citrus clementina cDNA clone C31004D04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868754 ID=FC868754|Name=FC868754|organism=Citrus clementina|type=EST|length=729bp
AAAGATAGTGCAGATAAGATTATAAGTGCTATAAGCTAAGGCCTCTCGAG
CTCAGAACCCACAGCAAGAAGAAGCAAAGAGGAAAATGGCCTCAGCCTCG
GCATCTTTACTCAAGTCATCATCCCCCGTTCTTGACAAGTCTGAGTGGGT
TAAGGGCCAGGCCATCCGCCAGTCTACTGTCTCAGTCCGCAGCCTCCCCA
GTGGCCCCTCTTCCCTCACCATCCGTGCTGGTTCCTATGCCGATGAGCTT
GTCAAGACCGCGAAAACTGTTGCATCACCAGGACGTGGAATTTTGGCCAT
GGATGAGTCAAATGCAACTTGTGGAAAACGCCTTGCCTCAATTGGGTTAG
AGAACACTGAGGCTAACCGCCAGGCATACCGTACCCTCCTTGTTACAGCC
CCTGGTCTTGGACAGTACATCTCTGGTGCCATCCTTTTTGAGGAGACTCT
CTACCAATCCACCACCGATGGCAAGAAGATGGTCGATGTTCTTGTTGAGC
AAAACATTGTCCCCGGTATCAAAGTCGACAAGGGTTTGGTGCCCCTTGCT
GGTTCCAATGATGAGTCATGGTGCCAGGGTCTTGATGGCCTGGCTTCTCG
CACTGCTGCTTACTACCAACAGGGAGCTCGTTTCGCCAAATGGCGTACTG
TTGTGAGCATTCCCATGGCCCATCTGCCTTGGCAGTCAGGAAGCCGCCTG
GGGTCTTGCCCGCTATGCTGCCATTGCTC
back to top