FC868754

Overview
NameFC868754
Unique NameFC868754
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length729
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF_ECHMU (Fructose-bisphosphate aldolase OS=Echinococcus multilocularis GN=FBPA PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 3.865e-38
Identity = 80/140 (57.14%), Postives = 98/140 (70.00%), Query Frame = 2
Query:  245 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTA-PGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            EL + A  + +PG+G+LA DES  T GKR A+I LENTE NR+AYR LL T  P   ++ISG ILF ET+YQ T DGK  V++L E+ ++PGIKVD G+VPL G+ DE   QGLD LA R A YY  G RFAKWR V+ I
Sbjct:   15 ELRENASAIVAPGKGLLAADESTNTIGKRFAAINLENTEENRRAYRELLFTTDPEFAKHISGVILFHETVYQKTKDGKPFVELLRERGVLPGIKVDLGVVPLGGTADECTTQGLDNLAQRCAQYYNDGCRFAKWRCVLKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF1_XANAC (Probable fructose-bisphosphate aldolase class 1 OS=Xanthomonas axonopodis pv. citri GN=XAC3344 PE=3 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 3.865e-38
Identity = 76/140 (54.29%), Postives = 99/140 (70.71%), Query Frame = 2
Query:  242 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            ++L +TA+ + +PG+GI+A+DES +T  KR AS+G+EN E NR+AYR LL+T P L  YISGAILF+ET+ Q T DG    + +    I+PGIKVDKG  PLAG   E   +GLDGL +R   YY  GARFAKWR V++I
Sbjct:    4 EQLAETAQAMVAPGKGIIAIDESTSTIAKRFASVGIENIEENRRAYRELLLTTPKLSDYISGAILFDETIRQKTKDGVPFAEYMTAHGIIPGIKVDKGAQPLAGMPGELVTEGLDGLRARLEEYYTLGARFAKWRAVINI 143          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF1_XANCP (Probable fructose-bisphosphate aldolase class 1 OS=Xanthomonas campestris pv. campestris GN=XCC3185 PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 5.047e-38
Identity = 75/140 (53.57%), Postives = 99/140 (70.71%), Query Frame = 2
Query:  242 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            ++L +TA+ + +PG+GI+A+DES +T  KR + +G+ENTE NR+AYR LL+T P L  YISGAILF+ET+ Q T DG      + +  I+PGIKVDKG  PLAG   E   +GLDGL +R   YY  GARFAKWR V++I
Sbjct:    4 EQLAETAQAMVAPGKGIIAIDESTSTIAKRFSGVGIENTEENRRAYRELLLTTPKLSDYISGAILFDETIRQKTKDGVPFAKYMADHGIIPGIKVDKGAQPLAGMPGELVTEGLDGLRARLEEYYTLGARFAKWRAVINI 143          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF2_CAEEL (Fructose-bisphosphate aldolase 2 OS=Caenorhabditis elegans GN=aldo-2 PE=1 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.124e-37
Identity = 83/150 (55.33%), Postives = 101/150 (67.33%), Query Frame = 2
Query:  242 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIPMAHLPWQSG 691
            DEL + A  +   G+GILA DES  T GKRL +I LEN E NRQ YR LL T P L Q+ISG IL+EET +QST  G+K  D+L++Q IVPGIK+D G+VPLAG+  E   QGLD LA R AA+ + G  FAKWR V++I   H P   G
Sbjct:   18 DELHQIALKIVQDGKGILAADESTGTIGKRLDAINLENNETNRQKYRQLLFTTPNLNQHISGVILYEETFHQSTDKGEKFTDLLIKQGIVPGIKLDLGVVPLAGTIGEGTTQGLDKLAERAAAFKKGGCGFAKWRCVLNIG-THTPSHLG 166          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF1_XYLFT (Probable fructose-bisphosphate aldolase class 1 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=PD_1845 PE=3 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.624e-36
Identity = 75/140 (53.57%), Postives = 98/140 (70.00%), Query Frame = 2
Query:  242 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            ++L +TA+ + + G+GI+A+DES  T  KR +S+G+EN E NR+AYR LL+T P L  YISGAILF+ET+ QST  G      + E  I+PGIKVDKG  PLAG   E   +GLDGL +R   YY+ GARFAKWR V++I
Sbjct:    4 EQLAETAQAMVASGKGIIAIDESAGTIAKRFSSVGIENIEENRRAYRELLLTTPKLSDYISGAILFDETIRQSTKAGVPFPKYMAEHGIIPGIKVDKGAYPLAGCPGELVTEGLDGLRARLEEYYKLGARFAKWRAVINI 143          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF1_CAEEL (Fructose-bisphosphate aldolase 1 OS=Caenorhabditis elegans GN=aldo-1 PE=1 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.624e-36
Identity = 81/141 (57.45%), Postives = 96/141 (68.09%), Query Frame = 2
Query:  242 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            DEL   A  + +PG+GILA DES  +  KRL SIGLENTE NR+ YR LL TA   L +YISG I+F ET YQ T DGK    +L EQ I+PGIKVDKG+VP+AG+  E   QGLD L +R A Y + GA+FAKWR V  I
Sbjct:   14 DELRSIANAIVTPGKGILAADESTGSMDKRLNSIGLENTEENRRKYRQLLFTAGADLNKYISGVIMFHETFYQKTDDGKPFTALLQEQGIIPGIKVDKGVVPMAGTIGEGTTQGLDDLNARCAQYKKDGAQFAKWRCVHKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF1_XYLFA (Probable fructose-bisphosphate aldolase class 1 OS=Xylella fastidiosa GN=XF_0826 PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 3.617e-36
Identity = 74/140 (52.86%), Postives = 98/140 (70.00%), Query Frame = 2
Query:  242 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            ++L +TA+ + + G+GI+A+DES  T  KR +S+G+EN E NR+AYR LL+T P L  YISGAILF+ET+ QST  G      + +  I+PGIKVDKG  PLAG   E   +GLDGL +R   YY+ GARFAKWR V++I
Sbjct:    4 EQLAETAQAMVASGKGIIAIDESAGTIAKRFSSVGIENIEENRRAYRELLLTTPKLSDYISGAILFDETIRQSTKAGVPFPKYMADHGIIPGIKVDKGAYPLAGCPGELVTEGLDGLRARLEEYYKLGARFAKWRAVINI 143          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF_DROME (Fructose-bisphosphate aldolase OS=Drosophila melanogaster GN=Ald PE=1 SV=5)

HSP 1 Score: 150.984 bits (380), Expect = 6.170e-36
Identity = 80/141 (56.74%), Postives = 97/141 (68.79%), Query Frame = 2
Query:  242 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLV-TAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            DEL + A+ + +PG+GILA DES  T GKRL  IG+ENTE NR+AYR LL  T P L + ISG ILF ETLYQ   DG    ++L ++ I+ GIKVDKG+VPL GS DE   QGLD LA+R A Y + G  FAKWR V+ I
Sbjct:   14 DELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF2_LAMJA (Fructose-bisphosphate aldolase, non-muscle type OS=Lampetra japonica PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 9.851e-34
Identity = 75/140 (53.57%), Postives = 97/140 (69.29%), Query Frame = 2
Query:  245 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTA-PGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            EL + A+ + S G+GILA DES  T GKRL++I +EN + NR+ YR LL ++ P + + I G I +EETLYQ T DG   V ++ ++ IV GIKVDKG VPLAG++ ES  QGLDGLA R A Y + GA FAKWR V+ I
Sbjct:   15 ELAEIAQRIVSNGKGILAADESTGTMGKRLSAIKVENVDENRRVYRQLLFSSDPSVTKAIGGVIFYEETLYQKTDDGTPFVKLIKDRGIVVGIKVDKGTVPLAGTDGESTTQGLDGLAERCARYKKDGADFAKWRCVLKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALDCB_DANRE (Fructose-bisphosphate aldolase C-B OS=Danio rerio GN=aldocb PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.195e-33
Identity = 74/140 (52.86%), Postives = 96/140 (68.57%), Query Frame = 2
Query:  245 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            EL   A+ + +PG+GILA DES  +  KRL  IG+ENTE NR+ YR LL +A   + + I G I F ETLYQ+T DG     ++ ++ IV GIKVDKG+VPLAG+N E+  QGLDGL+ R A Y + GA FAKWR+V+ I
Sbjct:   15 ELQDIAQRIVAPGKGILAADESTGSMAKRLNPIGVENTEENRRLYRQLLFSADERIDKCIGGVIFFHETLYQNTDDGTNFAQLIKDRGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLKI 154          
The following BLAST results are available for this feature:
BLAST of FC868754 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALF_ECHMU3.865e-3857.14Fructose-bisphosphate aldolase OS=Echinococcus mul... [more]
ALF1_XANAC3.865e-3854.29Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALF1_XANCP5.047e-3853.57Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALF2_CAEEL1.124e-3755.33Fructose-bisphosphate aldolase 2 OS=Caenorhabditis... [more]
ALF1_XYLFT1.624e-3653.57Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALF1_CAEEL1.624e-3657.45Fructose-bisphosphate aldolase 1 OS=Caenorhabditis... [more]
ALF1_XYLFA3.617e-3652.86Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALF_DROME6.170e-3656.74Fructose-bisphosphate aldolase OS=Drosophila melan... [more]
ALF2_LAMJA9.851e-3453.57Fructose-bisphosphate aldolase, non-muscle type OS... [more]
ALDCB_DANRE2.195e-3352.86Fructose-bisphosphate aldolase C-B OS=Danio rerio ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31004D04EF AbioticL1 Citrus clementina cDNA clone C31004D04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868754 ID=FC868754; Name=FC868754; organism=Citrus clementina; type=EST; length=729bp
AAAGATAGTGCAGATAAGATTATAAGTGCTATAAGCTAAGGCCTCTCGAG
CTCAGAACCCACAGCAAGAAGAAGCAAAGAGGAAAATGGCCTCAGCCTCG
GCATCTTTACTCAAGTCATCATCCCCCGTTCTTGACAAGTCTGAGTGGGT
TAAGGGCCAGGCCATCCGCCAGTCTACTGTCTCAGTCCGCAGCCTCCCCA
GTGGCCCCTCTTCCCTCACCATCCGTGCTGGTTCCTATGCCGATGAGCTT
GTCAAGACCGCGAAAACTGTTGCATCACCAGGACGTGGAATTTTGGCCAT
GGATGAGTCAAATGCAACTTGTGGAAAACGCCTTGCCTCAATTGGGTTAG
AGAACACTGAGGCTAACCGCCAGGCATACCGTACCCTCCTTGTTACAGCC
CCTGGTCTTGGACAGTACATCTCTGGTGCCATCCTTTTTGAGGAGACTCT
CTACCAATCCACCACCGATGGCAAGAAGATGGTCGATGTTCTTGTTGAGC
AAAACATTGTCCCCGGTATCAAAGTCGACAAGGGTTTGGTGCCCCTTGCT
GGTTCCAATGATGAGTCATGGTGCCAGGGTCTTGATGGCCTGGCTTCTCG
CACTGCTGCTTACTACCAACAGGGAGCTCGTTTCGCCAAATGGCGTACTG
TTGTGAGCATTCCCATGGCCCATCTGCCTTGGCAGTCAGGAAGCCGCCTG
GGGTCTTGCCCGCTATGCTGCCATTGCTC
back to top