FC868754

Overview
NameFC868754
Unique NameFC868754
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length729
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14114 contig Ccv1_Contig14114:20..750. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF1_LAMJA (Fructose-bisphosphate aldolase, muscle type OS=Lampetra japonica PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 4.889e-33
Identity = 74/140 (52.86%), Postives = 93/140 (66.43%), Query Frame = 2
Query:  245 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTA-PGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            EL   A+ + + G+GILA DES  T GKRL  IGLENT+ +R+ YR LL T  P + ++I G I F ET+YQ T  G   V ++ +  I+ GIKVDKG+VPLAG+N E   QGLDGLA R A Y + GA FAKWR V+ I
Sbjct:   15 ELADIAQRIVASGKGILAADESVGTMGKRLTQIGLENTDEHRRFYRQLLFTTDPSIKEHIGGIIFFHETMYQKTDGGVPFVKLVKDNGILVGIKVDKGVVPLAGTNGEGTTQGLDGLAERCAQYKKDGADFAKWRCVLKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALDOA_RAT (Fructose-bisphosphate aldolase A OS=Rattus norvegicus GN=Aldoa PE=1 SV=2)

HSP 1 Score: 141.354 bits (355), Expect = 4.889e-33
Identity = 76/140 (54.29%), Postives = 92/140 (65.71%), Query Frame = 2
Query:  245 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            EL   A  + +PG+GILA DES  +  KRL SIG ENTE NR+ YR LL+TA   +   I G ILF ETLYQ   DG+    V+  +  V GIKVDKG+VPLAG+N E+  QGLDGL+ R A Y + GA FAKWR V+ I
Sbjct:   15 ELADIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALDOC_CARAU (Fructose-bisphosphate aldolase C OS=Carassius auratus GN=aldoc PE=2 SV=2)

HSP 1 Score: 140.969 bits (354), Expect = 6.385e-33
Identity = 74/140 (52.86%), Postives = 94/140 (67.14%), Query Frame = 2
Query:  245 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            EL   A+ + +PG+GILA DES  +  KRL  IG+ENTE NR+ YR LL TA   + + I G I F ETLYQ   DG     ++ ++ IV GIKVDKG+VPLAG+N E+  QGLDGL+ R A Y + GA FAKWR+V+ I
Sbjct:   15 ELQDIAQRIVAPGKGILAADESTGSMAKRLNPIGVENTEENRRLYRQLLFTADERMDKCIGGVIFFHETLYQKADDGTPFAKMIKDRGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALDOA_RABIT (Fructose-bisphosphate aldolase A OS=Oryctolagus cuniculus GN=ALDOA PE=1 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 8.339e-33
Identity = 76/140 (54.29%), Postives = 92/140 (65.71%), Query Frame = 2
Query:  245 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            EL   A  + +PG+GILA DES  +  KRL SIG ENTE NR+ YR LL+TA   +   I G ILF ETLYQ   DG+    V+  +  V GIKVDKG+VPLAG+N E+  QGLDGL+ R A Y + GA FAKWR V+ I
Sbjct:   15 ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALDOA_PONAB (Fructose-bisphosphate aldolase A OS=Pongo abelii GN=ALDOA PE=2 SV=3)

HSP 1 Score: 140.584 bits (353), Expect = 8.339e-33
Identity = 76/140 (54.29%), Postives = 92/140 (65.71%), Query Frame = 2
Query:  245 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            EL   A  + +PG+GILA DES  +  KRL SIG ENTE NR+ YR LL+TA   +   I G ILF ETLYQ   DG+    V+  +  V GIKVDKG+VPLAG+N E+  QGLDGL+ R A Y + GA FAKWR V+ I
Sbjct:   15 ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALDOA_MOUSE (Fructose-bisphosphate aldolase A OS=Mus musculus GN=Aldoa PE=1 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 8.339e-33
Identity = 76/140 (54.29%), Postives = 92/140 (65.71%), Query Frame = 2
Query:  245 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            EL   A  + +PG+GILA DES  +  KRL SIG ENTE NR+ YR LL+TA   +   I G ILF ETLYQ   DG+    V+  +  V GIKVDKG+VPLAG+N E+  QGLDGL+ R A Y + GA FAKWR V+ I
Sbjct:   15 ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALDOA_HUMAN (Fructose-bisphosphate aldolase A OS=Homo sapiens GN=ALDOA PE=1 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 8.339e-33
Identity = 76/140 (54.29%), Postives = 92/140 (65.71%), Query Frame = 2
Query:  245 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            EL   A  + +PG+GILA DES  +  KRL SIG ENTE NR+ YR LL+TA   +   I G ILF ETLYQ   DG+    V+  +  V GIKVDKG+VPLAG+N E+  QGLDGL+ R A Y + GA FAKWR V+ I
Sbjct:   15 ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALDOA_PANTR (Fructose-bisphosphate aldolase A OS=Pan troglodytes GN=ALDOA PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.422e-32
Identity = 76/140 (54.29%), Postives = 92/140 (65.71%), Query Frame = 2
Query:  245 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            EL   A  + +PG+GILA DES  +  KRL SIG ENTE NR+ YR LL+TA   +   I G ILF ETLYQ   DG+    V+  +  V GIKVDKG+VPLAG+N E+  QGLDGL+ R A Y + GA FAKWR V+ I
Sbjct:   15 ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIVGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALF_TRYBB (Fructose-bisphosphate aldolase, glycosomal OS=Trypanosoma brucei brucei GN=ALD PE=1 SV=2)

HSP 1 Score: 135.576 bits (340), Expect = 2.683e-31
Identity = 68/143 (47.55%), Postives = 85/143 (59.44%), Query Frame = 2
Query:  236 YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLA-GSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            Y  EL++TAK + +PG+G+LA DES  +C KR A IGL NT  +R+ YR L++   G  QYISG IL +ET+YQ    G+     L  + +VPGIK D GL PL  G+  E    GLDG   R   YY  G RF KWR V  I
Sbjct:   22 YEAELIETAKKMTAPGKGLLAADESTGSCSKRFAGIGLSNTAEHRRQYRALMLECEGFEQYISGVILHDETVYQKAKTGETFPQYLRRRGVVPGIKTDCGLEPLVEGAKGEQMTAGLDGYIKRAKKYYAMGCRFCKWRNVYKI 164          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALDCA_DANRE (Fructose-bisphosphate aldolase C-A OS=Danio rerio GN=aldoca PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.504e-31
Identity = 72/140 (51.43%), Postives = 93/140 (66.43%), Query Frame = 2
Query:  245 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            EL + A  + SPG+GILA DES  + GKRL  IG+EN E NR+ +R +L TA   +   I G I F ETLYQ++ DG   V ++ ++ I  GIKVDKG+VPL G+N E+  QGLDGL+ R A Y + GA FAKWR V+ I
Sbjct:   15 ELHEIALRIVSPGKGILAADESIGSMGKRLNQIGVENNEENRRLFRQVLFTADDRIDNCIGGVIFFHETLYQNSDDGVPFVKMIKDKGITIGIKVDKGVVPLPGTNGETATQGLDGLSERCAQYKKDGADFAKWRCVMKI 154          
The following BLAST results are available for this feature:
BLAST of FC868754 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALF1_LAMJA4.889e-3352.86Fructose-bisphosphate aldolase, muscle type OS=Lam... [more]
ALDOA_RAT4.889e-3354.29Fructose-bisphosphate aldolase A OS=Rattus norvegi... [more]
ALDOC_CARAU6.385e-3352.86Fructose-bisphosphate aldolase C OS=Carassius aura... [more]
ALDOA_RABIT8.339e-3354.29Fructose-bisphosphate aldolase A OS=Oryctolagus cu... [more]
ALDOA_PONAB8.339e-3354.29Fructose-bisphosphate aldolase A OS=Pongo abelii G... [more]
ALDOA_MOUSE8.339e-3354.29Fructose-bisphosphate aldolase A OS=Mus musculus G... [more]
ALDOA_HUMAN8.339e-3354.29Fructose-bisphosphate aldolase A OS=Homo sapiens G... [more]
ALDOA_PANTR1.422e-3254.29Fructose-bisphosphate aldolase A OS=Pan troglodyte... [more]
ALF_TRYBB2.683e-3147.55Fructose-bisphosphate aldolase, glycosomal OS=Tryp... [more]
ALDCA_DANRE3.504e-3151.43Fructose-bisphosphate aldolase C-A OS=Danio rerio ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31004D04EF AbioticL1 Citrus clementina cDNA clone C31004D04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868754 ID=FC868754|Name=FC868754|organism=Citrus clementina|type=EST|length=729bp
AAAGATAGTGCAGATAAGATTATAAGTGCTATAAGCTAAGGCCTCTCGAG
CTCAGAACCCACAGCAAGAAGAAGCAAAGAGGAAAATGGCCTCAGCCTCG
GCATCTTTACTCAAGTCATCATCCCCCGTTCTTGACAAGTCTGAGTGGGT
TAAGGGCCAGGCCATCCGCCAGTCTACTGTCTCAGTCCGCAGCCTCCCCA
GTGGCCCCTCTTCCCTCACCATCCGTGCTGGTTCCTATGCCGATGAGCTT
GTCAAGACCGCGAAAACTGTTGCATCACCAGGACGTGGAATTTTGGCCAT
GGATGAGTCAAATGCAACTTGTGGAAAACGCCTTGCCTCAATTGGGTTAG
AGAACACTGAGGCTAACCGCCAGGCATACCGTACCCTCCTTGTTACAGCC
CCTGGTCTTGGACAGTACATCTCTGGTGCCATCCTTTTTGAGGAGACTCT
CTACCAATCCACCACCGATGGCAAGAAGATGGTCGATGTTCTTGTTGAGC
AAAACATTGTCCCCGGTATCAAAGTCGACAAGGGTTTGGTGCCCCTTGCT
GGTTCCAATGATGAGTCATGGTGCCAGGGTCTTGATGGCCTGGCTTCTCG
CACTGCTGCTTACTACCAACAGGGAGCTCGTTTCGCCAAATGGCGTACTG
TTGTGAGCATTCCCATGGCCCATCTGCCTTGGCAGTCAGGAAGCCGCCTG
GGGTCTTGCCCGCTATGCTGCCATTGCTC
back to top