FC868853
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP172_ARATH (Pentatricopeptide repeat-containing protein At2g27610 OS=Arabidopsis thaliana GN=PCMP-H60 PE=2 SV=1) HSP 1 Score: 63.5438 bits (153), Expect = 4.946e-16 Identity = 26/49 (53.06%), Postives = 34/49 (69.39%), Query Frame = -1 Query: 108 VTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEG-GTCSCNDYW 251 + KN+RVC D H + I+ I R+I+VRD+NRFHHF G CSC D+W Sbjct: 820 IIKNLRVCGDCHLVIKLIAKIEEREIVVRDSNRFHHFSSDGVCSCGDFW 868 HSP 2 Score: 41.5874 bits (96), Expect = 4.946e-16 Identity = 18/52 (34.62%), Postives = 31/52 (59.62%), Query Frame = -3 Query: 280 EVYKKVESMSVEIKMAGCMPDLSCALHDVEVEDRELMMYYPSENLDVVFGIM 435 ++Y K+E +S +K G PD S L D++ E +E ++ SE L + FG++ Sbjct: 759 QIYMKLEDLSTRLKDLGYEPDTSYVLQDIDDEHKEAVLAQHSERLAIAFGLI 810
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP108_ARATH (Putative pentatricopeptide repeat-containing protein At1g68930 OS=Arabidopsis thaliana GN=PCMP-H22 PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 6.450e-16 Identity = 29/50 (58.00%), Postives = 38/50 (76.00%), Query Frame = -1 Query: 108 IQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 257 I+V KN+RVC D H+A + IS + R+I+VRDA RFH F+ GTCSC D+W Sbjct: 694 IRVGKNLRVCVDCHNATKHISSVTGREILVRDAVRFHRFKDGTCSCGDFW 743 HSP 2 Score: 38.1206 bits (87), Expect = 6.450e-16 Identity = 19/52 (36.54%), Postives = 30/52 (57.69%), Query Frame = -3 Query: 280 EVYKKVESMSVEIKMAGCMPDLSCALHDVEVEDRELMMYYPSENLDVVFGIM 435 ++Y K+E ++ +I G PD S HDVE + M+ Y SE L + FG++ Sbjct: 635 QIYAKLEELNNKIIDNGYKPDTSFVHHDVEEAVKVKMLNYHSERLAIAFGLI 686
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PPR85_ARATH (Pentatricopeptide repeat-containing protein At1g59720, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H51 PE=2 SV=2) HSP 1 Score: 73.1738 bits (178), Expect = 1.093e-15 Identity = 30/56 (53.57%), Postives = 40/56 (71.43%), Query Frame = -1 Query: 108 LSPEAVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 275 L P+ I++ KN+RVCND H + IS ++ +IIVRD RFHHF+ G+CSC DYW Sbjct: 583 LPPQTPIRIFKNLRVCNDCHEVTKLISKVFNTEIIVRDRVRFHHFKDGSCSCLDYW 638 HSP 2 Score: 30.8018 bits (68), Expect = 1.093e-15 Identity = 18/60 (30.00%), Postives = 35/60 (58.33%), Query Frame = -3 Query: 265 KEVYKKVESMSVEIKMAGCMPDLSCA-LHDVEVE-DRELMMYYPSENLDVVFGIMNLIPR 438 K++Y++++ + ++ G +PD S A L D + +E + SE L + FG++NL P+ Sbjct: 527 KQIYQQLKVIDDRLRSIGYLPDRSQAPLVDATNDGSKEYSLRLHSERLAIAFGLINLPPQ 586
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP364_ARATH (Pentatricopeptide repeat-containing protein At5g04780 OS=Arabidopsis thaliana GN=PCMP-H16 PE=2 SV=2) HSP 1 Score: 64.6994 bits (156), Expect = 1.846e-15 Identity = 27/56 (48.21%), Postives = 35/56 (62.50%), Query Frame = -1 Query: 108 LSPEAVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 275 L + +++ KN+R+C D H + S RR IIVRD NRFHHF G CSC D+W Sbjct: 580 LPESSPVRIMKNLRICVDCHEFMKAASMATRRFIIVRDVNRFHHFSDGHCSCGDFW 635 HSP 2 Score: 38.5058 bits (88), Expect = 1.846e-15 Identity = 17/55 (30.91%), Postives = 33/55 (60.00%), Query Frame = -3 Query: 274 KEVYKKVESMSVEIKMAGCMPDLSCALHDVEVEDRELMMYYPSENLDVVFGIMNL 438 +E+ ++++ ++ + G P + LHDVE+ +E ++ SE L +VFG+M L Sbjct: 526 REICSTLDNLVIKFRKFGYKPSVEHELHDVEIGKKEELLMQHSEKLALVFGLMCL 580
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP410_ARATH (Putative pentatricopeptide repeat-containing protein At5g40405 OS=Arabidopsis thaliana GN=PCMP-H14 PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 1.848e-15 Identity = 30/56 (53.57%), Postives = 38/56 (67.86%), Query Frame = -1 Query: 108 LSPEAVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 275 L + I++ KN+RVC D H IS I+ R+IIVRD NRFHHF+ G CSCN +W Sbjct: 557 LKEDVPIRIVKNLRVCGDCHQVSMMISKIFNREIIVRDRNRFHHFKDGHCSCNGFW 612 HSP 2 Score: 31.187 bits (69), Expect = 1.848e-15 Identity = 14/48 (29.17%), Postives = 28/48 (58.33%), Query Frame = -3 Query: 274 ESMSVEIKMAGCMPDLSCALHDVEVEDRELMMYYPSENLDVVFGIMNL 417 + +S +++AG D + + D++ E++E + SE + FGIM+L Sbjct: 510 KDISRRLRLAGYKADTTPVMFDIDEEEKEDALCLHSEKAAIAFGIMSL 557
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP153_ARATH (Pentatricopeptide repeat-containing protein At2g15690 OS=Arabidopsis thaliana GN=PCMP-H66 PE=2 SV=2) HSP 1 Score: 67.0106 bits (162), Expect = 6.853e-15 Identity = 27/54 (50.00%), Postives = 35/54 (64.81%), Query Frame = -1 Query: 108 PEAVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 269 P + + KN+RVC D H+ + +S I R +IVRD RFHHF+ G CSC DYW Sbjct: 526 PRKTLTIIKNLRVCGDCHNFIKIMSKIIGRVLIVRDNKRFHHFKDGKCSCGDYW 579 HSP 2 Score: 34.2686 bits (77), Expect = 6.853e-15 Identity = 15/39 (38.46%), Postives = 23/39 (58.97%), Query Frame = -3 Query: 265 MPDLSCALHDVEVEDRELMMYYPSENLDVVFGIMNLIPR 381 +PD LHD++ E +E + Y SE L + +GI+ PR Sbjct: 489 VPDTRFVLHDIDQEAKEQALLYHSERLAIAYGIICTPPR 527
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP307_ARATH (Pentatricopeptide repeat-containing protein At4g13650 OS=Arabidopsis thaliana GN=PCMP-H42 PE=2 SV=2) HSP 1 Score: 79.337 bits (194), Expect = 7.369e-15 Identity = 33/50 (66.00%), Postives = 39/50 (78.00%), Query Frame = -1 Query: 108 IQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 257 I V KN+RVCND H+ +F+S + R+IIVRDA RFHHFEGG CSC DYW Sbjct: 1015 INVMKNLRVCNDCHAWIKFVSKVSNREIIVRDAYRFHHFEGGACSCKDYW 1064
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP427_ARATH (Pentatricopeptide repeat-containing protein At5g50390, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H58 PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 8.864e-15 Identity = 25/50 (50.00%), Postives = 36/50 (72.00%), Query Frame = -1 Query: 108 IQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 257 +Q+T+N R+C + H FIS + R+++VRDA+RFHHF+ G CSC YW Sbjct: 652 LQITQNHRICKNCHKVVEFISLVTGREMVVRDASRFHHFKEGKCSCGGYW 701 HSP 2 Score: 34.6538 bits (78), Expect = 8.864e-15 Identity = 16/54 (29.63%), Postives = 31/54 (57.41%), Query Frame = -3 Query: 277 KEVYKKVESMSVEIKMAGCMPDLSCALHDVEVEDRELMMYYPSENLDVVFGIMN 438 +++Y+KV+ + EI G + L DV+ ++ E + Y SE L + +G++N Sbjct: 592 RQIYQKVDELMEEISEYGYSEEEQHLLPDVDEKEEERVGRYHSEKLAIAYGLVN 645
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP446_ARATH (Pentatricopeptide repeat-containing protein At5g65570 OS=Arabidopsis thaliana GN=PCMP-H47 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 2.522e-14 Identity = 27/50 (54.00%), Postives = 37/50 (74.00%), Query Frame = -1 Query: 108 IQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 257 I++ KN+RVC D HS + +S + +R+II RD+ RFHHF G+CSC DYW Sbjct: 689 IRILKNLRVCVDCHSWIKIVSRVMKREIICRDSKRFHHFRDGSCSCGDYW 738 HSP 2 Score: 30.0314 bits (66), Expect = 2.522e-14 Identity = 13/52 (25.00%), Postives = 27/52 (51.92%), Query Frame = -3 Query: 283 KEVYKKVESMSVEIKMAGCMPDLSCALHDVEVEDRELMMYYPSENLDVVFGI 438 +++ + +E + + K G + D SC D+E +E ++ SE L + F + Sbjct: 630 EQILENLEELIKKSKDLGYVEDKSCVFQDMEETAKERSLHQHSEKLAIAFAV 681
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP411_ARATH (Pentatricopeptide repeat-containing protein At5g40410, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H15 PE=2 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 4.277e-14 Identity = 29/57 (50.88%), Postives = 41/57 (71.93%), Query Frame = -1 Query: 108 ILSPEAVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 278 ++SP I + KN+R+C D H + IS I +R+II+RD+ RFHHF G+CSC+DYW Sbjct: 552 VVSPMEPIIIRKNLRICGDCHETAKAISLIEKRRIIIRDSKRFHHFLDGSCSCSDYW 608 HSP 2 Score: 26.1794 bits (56), Expect = 4.277e-14 Identity = 17/57 (29.82%), Postives = 28/57 (49.12%), Query Frame = -3 Query: 268 KEVYKKVESMSVEIKMAGCMPDLSCALHDVEVEDRELMMYYPSENLDVVFGIMNLIP 438 KE+ KK++S G LHDV + +E M+ SE + + FG++ + P Sbjct: 505 KEIRKKMKSEM------GYKSKTEFVLHDVGEDVKEEMINQHSEKIAMAFGLLVVSP 555 The following BLAST results are available for this feature:
BLAST of FC868853 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 77
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC868853 ID=FC868853; Name=FC868853; organism=Citrus clementina; type=EST; length=440bpback to top |