FC868853
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP175_ARATH (Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H33 PE=2 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 4.777e-14 Identity = 35/59 (59.32%), Postives = 43/59 (72.88%), Query Frame = -1 Query: 108 ILSPEA--VIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 278 ++S EA VI+V KN+RVC D HS + IS +Y R+IIVRD RFHHF G CSCND+W Sbjct: 680 LISTEAPKVIRVIKNLRVCGDCHSVAKLISQLYDREIIVRDRYRFHHFRNGQCSCNDFW 738
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP229_ARATH (Pentatricopeptide repeat-containing protein At3g14330 OS=Arabidopsis thaliana GN=PCMP-H57 PE=2 SV=2) HSP 1 Score: 70.4774 bits (171), Expect = 5.535e-14 Identity = 28/50 (56.00%), Postives = 36/50 (72.00%), Query Frame = -1 Query: 108 IQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 257 I++TKN+RVC D HS + +S + RR I++RD RFHHF G CSC DYW Sbjct: 661 IRITKNLRVCADCHSWMKIVSQVTRRVIVLRDTKRFHHFVDGICSCKDYW 710 HSP 2 Score: 27.7202 bits (60), Expect = 5.535e-14 Identity = 16/52 (30.77%), Postives = 27/52 (51.92%), Query Frame = -3 Query: 277 YKKV-ESMSVEIKMAGCMPDLSCALHDVEVEDRELMMYYPSENLDVVFGIMN 429 YKKV + I+ +G P+ S LHDV+ E + + SE L + +++ Sbjct: 603 YKKVWTELQEAIEKSGYSPNTSVVLHDVDEETKANWVCGHSERLATTYSLIH 654
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP249_ARATH (Pentatricopeptide repeat-containing protein At3g22690 OS=Arabidopsis thaliana GN=PCMP-H56 PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 7.160e-14 Identity = 27/50 (54.00%), Postives = 37/50 (74.00%), Query Frame = -1 Query: 108 IQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 257 I++ KN+RVC+D HS +F S +Y R+II+RD NRFH+ G CSC D+W Sbjct: 793 IRIVKNLRVCSDCHSFAKFASKVYNREIILRDNNRFHYIRQGKCSCGDFW 842 HSP 2 Score: 29.261 bits (64), Expect = 7.160e-14 Identity = 14/48 (29.17%), Postives = 28/48 (58.33%), Query Frame = -3 Query: 277 VESMSVEIKMAGCMPDLSCALHDVEVEDRELMMYYPSENLDVVFGIMN 420 ++ +S G +PDLS L DV+ +++ M+ SE L + +G+++ Sbjct: 739 LDEVSQRASHLGHVPDLSNVLMDVDEKEKIFMLSRHSEKLAMAYGLIS 786
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP147_ARATH (Pentatricopeptide repeat-containing protein At2g03880, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H44 PE=2 SV=1) HSP 1 Score: 63.929 bits (154), Expect = 7.211e-14 Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = -1 Query: 108 EAVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 266 E VI++ KN+R+C D H + S + R I++RD R+HHF+ G CSC DYW Sbjct: 578 EKVIRIRKNLRICGDCHVFCKLASKLEIRSIVIRDPIRYHHFQDGKCSCGDYW 630 HSP 2 Score: 33.8834 bits (76), Expect = 7.211e-14 Identity = 18/54 (33.33%), Postives = 29/54 (53.70%), Query Frame = -3 Query: 274 EVYKKVESMSVEIKMAGCMPDLSCALHDVEVEDRELMMYYPSENLDVVFGIMNL 435 EV KK+ + + G +P+ + L D+E E E + + SE L + FG+M L Sbjct: 522 EVSKKLNQLIHRLTGIGYVPETNFVLQDLEGEQMEDSLRHHSEKLALAFGLMTL 575
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP114_ARATH (Pentatricopeptide repeat-containing protein At1g71420 OS=Arabidopsis thaliana GN=PCMP-H70 PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 1.212e-13 Identity = 25/51 (49.02%), Postives = 38/51 (74.51%), Query Frame = -1 Query: 108 VIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 260 +IQ+ KN R+C D H+ + S + ++I++RD+NRFHHF+ +CSCNDYW Sbjct: 695 LIQIMKNTRICIDCHNFMKLASKLLGKEILMRDSNRFHHFKDSSCSCNDYW 745 HSP 2 Score: 29.261 bits (64), Expect = 1.212e-13 Identity = 15/52 (28.85%), Postives = 31/52 (59.62%), Query Frame = -3 Query: 280 VYKKVESMSVEIKMAGCMPDLSCALHDVEVEDREL-MMYYPSENLDVVFGIM 432 VY++++ + +K G +P++ A D+E E++E + + SE L + F +M Sbjct: 632 VYRELKRLISWLKEMGYVPEMRSASQDIEDEEQEEDNLLHHSEKLALAFAVM 683
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP330_ARATH (Pentatricopeptide repeat-containing protein At4g21065 OS=Arabidopsis thaliana GN=PCMP-H28 PE=2 SV=2) HSP 1 Score: 75.0998 bits (183), Expect = 1.390e-13 Identity = 32/58 (55.17%), Postives = 43/58 (74.14%), Query Frame = -1 Query: 108 ILSPE-AVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 278 I +PE + I V KN+RVC D H A + +S +Y R+I+VRD +RFHHF+ G+CSC DYW Sbjct: 538 ISTPERSPITVVKNLRVCADCHLAIKLVSKVYNREIVVRDRSRFHHFKNGSCSCQDYW 595
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP296_ARATH (Pentatricopeptide repeat-containing protein At3g63370 OS=Arabidopsis thaliana GN=PCMP-H83 PE=2 SV=2) HSP 1 Score: 75.0998 bits (183), Expect = 1.390e-13 Identity = 29/52 (55.77%), Postives = 40/52 (76.92%), Query Frame = -1 Query: 108 AVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 263 A +++TKN+RVC D H+ + +S ++RR I++RDANRFHHFE G CSC D W Sbjct: 909 ACLRITKNLRVCRDCHTFCKLVSKLFRRDIVMRDANRFHHFESGLCSCGDSW 960
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP219_ARATH (Putative pentatricopeptide repeat-containing protein At3g08820 OS=Arabidopsis thaliana GN=PCMP-H84 PE=3 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 1.815e-13 Identity = 32/51 (62.75%), Postives = 38/51 (74.51%), Query Frame = -1 Query: 108 VIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 260 VI+V KN+RVC D H + IS I RR+I+VRD NRFH F G+CSCNDYW Sbjct: 635 VIRVVKNLRVCGDCHEVMKLISKITRREIVVRDNNRFHCFTNGSCSCNDYW 685
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP449_ARATH (Pentatricopeptide repeat-containing protein At5g66520 OS=Arabidopsis thaliana GN=PCMP-H61 PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.371e-13 Identity = 29/54 (53.70%), Postives = 37/54 (68.52%), Query Frame = -1 Query: 108 PEAVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 269 P +I++ KN+RVC D H + IS IY+R I++RD RFHHF G CSC DYW Sbjct: 567 PGTIIRIMKNLRVCKDCHKVTKLISKIYKRDIVMRDRTRFHHFRDGKCSCGDYW 620
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PPR48_ARATH (Pentatricopeptide repeat-containing protein At1g18485 OS=Arabidopsis thaliana GN=PCMP-H8 PE=2 SV=2) HSP 1 Score: 70.4774 bits (171), Expect = 4.449e-13 Identity = 29/55 (52.73%), Postives = 38/55 (69.09%), Query Frame = -1 Query: 108 SPEAVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 272 S I+V KN+R+C D H+A + IS + R+I+VRD RFHHF+ G CSC DYW Sbjct: 916 SEGTTIRVYKNLRICVDCHNAAKLISKVMEREIVVRDNKRFHHFKNGVCSCGDYW 970 HSP 2 Score: 24.6386 bits (52), Expect = 4.449e-13 Identity = 11/44 (25.00%), Postives = 22/44 (50.00%), Query Frame = -3 Query: 280 MSVEIKMAGCMPDLSCALHDVEVEDRELMMYYPSENLDVVFGIM 411 + ++I G PD HD+ E++ + SE L + +G++ Sbjct: 870 LEMKISKMGYRPDTMSVQHDLSEEEKIEQLRGHSEKLALTYGLI 913 The following BLAST results are available for this feature:
BLAST of FC868853 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 77
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC868853 ID=FC868853; Name=FC868853; organism=Citrus clementina; type=EST; length=440bpback to top |