FC868853
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP284_ARATH (Pentatricopeptide repeat-containing protein At3g56550 OS=Arabidopsis thaliana GN=PCMP-H80 PE=2 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 5.281e-13 Identity = 29/50 (58.00%), Postives = 38/50 (76.00%), Query Frame = -1 Query: 108 IQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 257 +++TKN+RVC D HS +++S + R+IIVRD RFHHF G CSCNDYW Sbjct: 532 LRITKNLRVCRDCHSFTKYVSKAFNREIIVRDRVRFHHFADGICSCNDYW 581
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PPR10_ARATH (Pentatricopeptide repeat-containing protein At1g04840 OS=Arabidopsis thaliana GN=PCMP-H64 PE=2 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 9.009e-13 Identity = 27/55 (49.09%), Postives = 40/55 (72.73%), Query Frame = -1 Query: 108 SPEAVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 272 +P I++ KN+R+C D HS +++S I +R I++RDA +FHHF+ G CSC DYW Sbjct: 611 APGTTIRIIKNLRICGDCHSLMKYVSKISQRDILLRDARQFHHFKDGRCSCGDYW 665
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP295_ARATH (Pentatricopeptide repeat-containing protein At3g62890 OS=Arabidopsis thaliana GN=PCMP-H82 PE=2 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 1.177e-12 Identity = 26/54 (48.15%), Postives = 38/54 (70.37%), Query Frame = -1 Query: 108 PEAVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 269 P +++ KN+R+C D H + IS ++ R+I+VRD NRFHHF G+CSC D+W Sbjct: 520 PGTPVRIIKNLRICGDCHLVMKMISKLFSREIVVRDCNRFHHFRDGSCSCRDFW 573
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP297_ARATH (Pentatricopeptide repeat-containing protein At4g01030, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H65 PE=2 SV=2) HSP 1 Score: 59.6918 bits (143), Expect = 1.272e-12 Identity = 22/52 (42.31%), Postives = 35/52 (67.31%), Query Frame = -1 Query: 108 AVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 263 A I+V KN +C+D H+ +++S + R+I++++ R HHF G CSCND W Sbjct: 717 APIRVVKNTNICSDSHTVAKYMSVLRNREIVLQEGARVHHFRDGKCSCNDSW 768 HSP 2 Score: 33.8834 bits (76), Expect = 1.272e-12 Identity = 13/52 (25.00%), Postives = 31/52 (59.62%), Query Frame = -3 Query: 280 EVYKKVESMSVEIKMAGCMPDLSCALHDVEVEDRELMMYYPSENLDVVFGIM 435 ++Y ++ + E+K +G +PD SC D+ ++E ++ +E L + +G++ Sbjct: 660 DIYFELYKLVSEMKKSGYVPDTSCIHQDISDSEKEKLLMGHTEKLAMTYGLI 711
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PPR32_ARATH (Pentatricopeptide repeat-containing protein At1g11290 OS=Arabidopsis thaliana GN=PCMP-H40 PE=2 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.537e-12 Identity = 29/50 (58.00%), Postives = 37/50 (74.00%), Query Frame = -1 Query: 108 IQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 257 I V KN+RVC D H+A ++IS + R+I+VRD RFHHF+ G CSC DYW Sbjct: 760 IHVRKNLRVCADCHNATKYISLVTGREIVVRDMQRFHHFKNGACSCGDYW 809
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP377_ARATH (Putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H89 PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 2.007e-12 Identity = 27/50 (54.00%), Postives = 37/50 (74.00%), Query Frame = -1 Query: 108 IQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 257 I + KN+R+C+D HSA + IS I +R +++RD NRFHHF G CSC D+W Sbjct: 773 ILIMKNLRICSDCHSAMKVISSIVQRDLVIRDMNRFHHFHAGVCSCGDHW 822
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP346_ARATH (Pentatricopeptide repeat-containing protein At4g32450, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H63 PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 2.166e-12 Identity = 27/52 (51.92%), Postives = 38/52 (73.08%), Query Frame = -1 Query: 108 AVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 263 ++I+V KN+RVC D H+A + +S I R++I RDA RFHH + G CSC +YW Sbjct: 486 SLIRVMKNLRVCADCHNALKLMSKIVGRELISRDAKRFHHMKDGVCSCREYW 537 HSP 2 Score: 26.1794 bits (56), Expect = 2.166e-12 Identity = 12/44 (27.27%), Postives = 25/44 (56.82%), Query Frame = -3 Query: 307 KEVYKKVESMSVEIKMAGCMPDLSCALHDVEVEDRELMMYYPSE 438 +E+Y ++S+ + G +P ALHDV+ E ++ ++ +E Sbjct: 428 RELYMALKSLKEHMIEIGYVPLSKLALHDVDQESKDENLFNHNE 471
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP313_ARATH (Pentatricopeptide repeat-containing protein At4g15720 OS=Arabidopsis thaliana GN=PCMP-H1 PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 4.471e-12 Identity = 27/52 (51.92%), Postives = 38/52 (73.08%), Query Frame = -1 Query: 108 AVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 263 + I++ N+R+C D H AF+ IS I R+I+VRD NRFH F+ G+C+C DYW Sbjct: 565 STIRIMNNLRMCRDCHEAFKLISEIVEREIVVRDVNRFHCFKNGSCTCRDYW 616
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP224_ARATH (Pentatricopeptide repeat-containing protein At3g12770 OS=Arabidopsis thaliana GN=PCMP-H43 PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 4.471e-12 Identity = 27/50 (54.00%), Postives = 38/50 (76.00%), Query Frame = -1 Query: 108 IQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 257 +++TKN+R C + H+A + IS + R+I+VRD NRFHHF+ G CSC DYW Sbjct: 645 LRITKNLRACVNCHAATKLISKLVDREIVVRDTNRFHHFKDGVCSCGDYW 694
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP210_ARATH (Pentatricopeptide repeat-containing protein At3g03580 OS=Arabidopsis thaliana GN=PCMP-H23 PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 5.839e-12 Identity = 31/54 (57.41%), Postives = 37/54 (68.52%), Query Frame = -1 Query: 108 PEAVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 269 P +QV KN+RVC D H + IS I R+I+VRDANRFH F+ GTCSC D W Sbjct: 829 PGTPLQVMKNLRVCGDCHEVTKLISKIVGREILVRDANRFHLFKDGTCSCKDRW 882 The following BLAST results are available for this feature:
BLAST of FC868853 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 77
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC868853 ID=FC868853; Name=FC868853; organism=Citrus clementina; type=EST; length=440bpback to top |