FC868853
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP320_ARATH (Pentatricopeptide repeat-containing protein At4g18750, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H45 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 7.626e-12 Identity = 27/51 (52.94%), Postives = 39/51 (76.47%), Query Frame = -1 Query: 108 VIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 260 +I+VTKN+RVC D H +F+S + RR+I++RD+NRFH F+ G CSC +W Sbjct: 821 IIRVTKNLRVCGDCHEMAKFMSKLTRREIVLRDSNRFHQFKDGHCSCRGFW 871
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP122_ARATH (Pentatricopeptide repeat-containing protein At1g74630 OS=Arabidopsis thaliana GN=PCMP-H71 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 7.626e-12 Identity = 28/56 (50.00%), Postives = 39/56 (69.64%), Query Frame = -1 Query: 108 LSPEAVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 275 LS A I++ KN+R+C D H+ + S +Y +I+VRD NRFH F+ G+CSC DYW Sbjct: 588 LSKGANIRIVKNLRICRDCHAVMKLTSKVYGVEILVRDRNRFHSFKDGSCSCRDYW 643
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP265_ARATH (Pentatricopeptide repeat-containing protein At3g46790, chloroplastic OS=Arabidopsis thaliana GN=CRR2 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 9.960e-12 Identity = 27/50 (54.00%), Postives = 36/50 (72.00%), Query Frame = -1 Query: 108 IQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 257 I++TKN+R+C D H +FIS ++I+VRD NRFH F+ G CSC DYW Sbjct: 608 IRITKNLRLCEDCHLFTKFISKFMEKEILVRDVNRFHRFKNGVCSCGDYW 657
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP417_ARATH (Pentatricopeptide repeat-containing protein At5g44230 OS=Arabidopsis thaliana GN=PCMP-H17 PE=2 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 2.929e-11 Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = -1 Query: 108 EAVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 266 ++ I + KN+R+C D H R S + + II+RD RFHHF G CSC D+W Sbjct: 605 DSTITIMKNLRMCLDCHKFMRLASEVTGKVIIMRDNMRFHHFRSGDCSCGDFW 657 HSP 2 Score: 29.261 bits (64), Expect = 2.929e-11 Identity = 13/52 (25.00%), Postives = 27/52 (51.92%), Query Frame = -3 Query: 280 EVYKKVESMSVEIKMAGCMPDLSCALHDVEVEDRELMMYYPSENLDVVFGIM 435 ++ K+E + + + G PDLS +DV + L++ +E L + F ++ Sbjct: 549 KIQDKLEELVERLTVLGYQPDLSSVPYDVSDNAKRLILIQHTEKLALAFSLL 600
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP223_ARATH (Putative pentatricopeptide repeat-containing protein At3g11460 OS=Arabidopsis thaliana GN=PCMP-H52 PE=3 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 3.808e-11 Identity = 28/54 (51.85%), Postives = 36/54 (66.67%), Query Frame = -1 Query: 108 PEAVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 269 P I V KN+RVC D H + +S I R+ +VRDA+RFH+F+ G CSC DYW Sbjct: 570 PGTEILVIKNLRVCEDCHVFLKQVSKIVDRQFVVRDASRFHYFKDGVCSCKDYW 623 HSP 2 Score: 22.7126 bits (47), Expect = 3.808e-11 Identity = 9/15 (60.00%), Postives = 11/15 (73.33%), Query Frame = -3 Query: 268 SENLDVVFGIMNLIP 312 SE L + FGI+N IP Sbjct: 556 SERLAIAFGILNSIP 570
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP428_ARATH (Pentatricopeptide repeat-containing protein At5g50990 OS=Arabidopsis thaliana GN=PCMP-H59 PE=2 SV=2) HSP 1 Score: 65.855 bits (159), Expect = 8.432e-11 Identity = 27/55 (49.09%), Postives = 37/55 (67.27%), Query Frame = -1 Query: 108 SPEAVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 272 SP I++ KN+R+C+D H+ + +S + R II+RD RFH FE G CSC DYW Sbjct: 480 SPGTEIRIQKNIRMCSDCHNWIKAVSKLLNRVIIMRDRIRFHRFEDGLCSCRDYW 534
BLAST of FC868853 vs. ExPASy Swiss-Prot
Match: PP378_ARATH (Pentatricopeptide repeat-containing protein At5g13270, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H90 PE=2 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 8.432e-11 Identity = 26/52 (50.00%), Postives = 36/52 (69.23%), Query Frame = -1 Query: 108 AVIQVTKNVRVCNDYHSAFRFISYIYRRKIIVRDANRFHHFEGGTCSCNDYW 263 A I+V KN+R C D H + +S + +I++RD+ RFHHF+ G CSCNDYW Sbjct: 701 APIKVFKNLRACPDCHEFAKHVSLVTGHEIVIRDSRRFHHFKEGKCSCNDYW 752 The following BLAST results are available for this feature:
BLAST of FC868853 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 77
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC868853 ID=FC868853; Name=FC868853; organism=Citrus clementina; type=EST; length=440bpback to top |