FC868861

Overview
NameFC868861
Unique NameFC868861
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length659
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9491 contig Ccv1_Contig9491:89..747. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: KCAB1_RABIT (Voltage-gated potassium channel subunit beta-1 OS=Oryctolagus cuniculus GN=KCNAB1 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.658e-18
Identity = 65/216 (30.09%), Postives = 109/216 (50.46%), Query Frame = 3
Query:   39 VPRVKLGTQGLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQ--LPREKILVATKFGIAGIGDTDIIVKG-SPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVH------PIAAVQMEWSLWTRD-IEEDIIPLCRELGIGIXPFSPL 656
            +P   LG  GL VS LG G     GG    +S+E    ++  A+  G+  FDTA+VY     EV+LG  +K+    R  +++ TK    G  +T+   +G S  ++    + SL+RL ++Y+D+ + +R D +  +EE +  M  ++ +G   Y G S  S   I  A++V       P    Q E+ L+ R+ +E  +  L  ++G+G   +SPL
Sbjct:   89 MPHRNLGKSGLRVSCLGLGTWVTFGGQ---ISDEVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETE---RGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPL 298          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: KCAB1_HUMAN (Voltage-gated potassium channel subunit beta-1 OS=Homo sapiens GN=KCNAB1 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.658e-18
Identity = 65/216 (30.09%), Postives = 109/216 (50.46%), Query Frame = 3
Query:   39 VPRVKLGTQGLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQ--LPREKILVATKFGIAGIGDTDIIVKG-SPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVH------PIAAVQMEWSLWTRD-IEEDIIPLCRELGIGIXPFSPL 656
            +P   LG  GL VS LG G     GG    +S+E    ++  A+  G+  FDTA+VY     EV+LG  +K+    R  +++ TK    G  +T+   +G S  ++    + SL+RL ++Y+D+ + +R D +  +EE +  M  ++ +G   Y G S  S   I  A++V       P    Q E+ L+ R+ +E  +  L  ++G+G   +SPL
Sbjct:   89 MPHRNLGKSGLRVSCLGLGTWVTFGGQ---ISDEVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETE---RGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPL 298          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: KCAB1_CHICK (Voltage-gated potassium channel subunit beta-1 OS=Gallus gallus GN=KCNAB1 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.658e-18
Identity = 66/211 (31.28%), Postives = 107/211 (50.71%), Query Frame = 3
Query:   54 LGTQGLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLP--REKILVATKFGIAGIGDTDIIVKG-SPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVH------PIAAVQMEWSLWTRD-IEEDIIPLCRELGIGIXPFSPL 656
            LG  GL VS LG G     GG    +S+E    ++  A+  G+  FDTA+VY     EV+LG  LK+    R  +++ TK    G  +T+   +G S  ++     ASL+RL ++Y+D+ + +R D +  +EE +  M  ++ +G   Y G S  S   I  A++V       P    Q E+ L+ R+ +E  +  L  ++G+G   +SPL
Sbjct:   76 LGKSGLRVSCLGLGTWVTFGGQ---ISDEVAEQLMTIAYESGVNLFDTAEVYAAGKAEVILGNILKKKGWRRSSLVITTKLYWGGKAETE---RGLSRKHIIEGLRASLQRLQLEYVDVVFANRPDNNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNLIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPL 280          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: KCAB2_HUMAN (Voltage-gated potassium channel subunit beta-2 OS=Homo sapiens GN=KCNAB2 PE=1 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 2.166e-18
Identity = 70/228 (30.70%), Postives = 115/228 (50.44%), Query Frame = 3
Query:    3 TTSSNMAEEKLQVPRVKLGTQGLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLP--REKILVATKFGIAGIGDTDIIVKG-SPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAV------HPIAAVQMEWSLWTRD-IEEDIIPLCRELGIGIXPFSPL 656
            +T     + +LQ  R  LG  GL VS LG G     GG  +    E  +T+   A+  GI  FDTA+VY     EV+LG  +K+    R  +++ TK    G  +T+   +G S  ++    +ASL+RL ++Y+D+ + +R D +  +EET+  M  ++ +G   Y G S  S   I  A++V       P    Q E+ ++ R+ +E  +  L  ++G+G   +SPL
Sbjct:   26 STRYGSPKRQLQFYR-NLGKSGLRVSCLGLGTWVTFGGQITDEMAEQLMTL---AYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETE---RGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLTPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPL 246          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: KCAB2_BOVIN (Voltage-gated potassium channel subunit beta-2 OS=Bos taurus GN=KCNAB2 PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.166e-18
Identity = 70/228 (30.70%), Postives = 115/228 (50.44%), Query Frame = 3
Query:    3 TTSSNMAEEKLQVPRVKLGTQGLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLP--REKILVATKFGIAGIGDTDIIVKG-SPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVH------PIAAVQMEWSLWTRD-IEEDIIPLCRELGIGIXPFSPL 656
            +T     + +LQ  R  LG  GL VS LG G     GG  +    E  +T+   A+  GI  FDTA+VY     EV+LG  +K+    R  +++ TK    G  +T+   +G S  ++    +ASL+RL ++Y+D+ + +R D +  +EET+  M  ++ +G   Y G S  S   I  A++V       P    Q E+ ++ R+ +E  +  L  ++G+G   +SPL
Sbjct:   26 STRYGSPKRQLQFYR-NLGKSGLRVSCLGLGTWVTFGGQITDEMAEQLMTL---AYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETE---RGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPL 246          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: KCAB2_RAT (Voltage-gated potassium channel subunit beta-2 OS=Rattus norvegicus GN=Kcnab2 PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 2.829e-18
Identity = 70/228 (30.70%), Postives = 115/228 (50.44%), Query Frame = 3
Query:    3 TTSSNMAEEKLQVPRVKLGTQGLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLP--REKILVATKFGIAGIGDTDIIVKG-SPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVH------PIAAVQMEWSLWTRD-IEEDIIPLCRELGIGIXPFSPL 656
            +T     + +LQ  R  LG  GL VS LG G     GG  +    E  +T+   A+  GI  FDTA+VY     EV+LG  +K+    R  +++ TK    G  +T+   +G S  ++    +ASL+RL ++Y+D+ + +R D +  +EET+  M  ++ +G   Y G S  S   I  A++V       P    Q E+ ++ R+ +E  +  L  ++G+G   +SPL
Sbjct:   26 STRYGSPKRQLQFYR-NLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTL---AYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETE---RGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPL 246          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: KCAB2_MOUSE (Voltage-gated potassium channel subunit beta-2 OS=Mus musculus GN=Kcnab2 PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 2.829e-18
Identity = 70/228 (30.70%), Postives = 115/228 (50.44%), Query Frame = 3
Query:    3 TTSSNMAEEKLQVPRVKLGTQGLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLP--REKILVATKFGIAGIGDTDIIVKG-SPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVH------PIAAVQMEWSLWTRD-IEEDIIPLCRELGIGIXPFSPL 656
            +T     + +LQ  R  LG  GL VS LG G     GG  +    E  +T+   A+  GI  FDTA+VY     EV+LG  +K+    R  +++ TK    G  +T+   +G S  ++    +ASL+RL ++Y+D+ + +R D +  +EET+  M  ++ +G   Y G S  S   I  A++V       P    Q E+ ++ R+ +E  +  L  ++G+G   +SPL
Sbjct:   26 STRYGSPKRQLQFYR-NLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTL---AYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETE---RGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPL 246          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: AAD14_YEAST (Putative aryl-alcohol dehydrogenase AAD14 OS=Saccharomyces cerevisiae GN=AAD14 PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 4.825e-18
Identity = 64/226 (28.32%), Postives = 108/226 (47.79%), Query Frame = 3
Query:   45 RVKLGTQGLEVSKLGFGCMNLS---GGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGK--ALKQLPREKILVATKFGIAGIGDTDIIVKGSPDYVRSC----------CEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRA------HAVHPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSPLG 659
            RV   T G+ VS L  G  ++     G+   +++E    ++   +  G    DTA+ Y    +E+ +G+  A ++L R++I++ATKF     GD      G       C             SL++L  D+ID+ Y H  D   +IEE +  +  LV++GK+ Y+G+S+     +  A      H   P +  Q +W++  RD E DIIP+ R  G+ + P+  +G
Sbjct:   19 RVLSKTAGIRVSPLILGGASIGDAWSGFMGSMNKEQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMASRKL-RDQIVIATKF----TGDYKKYEVGGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDILYIHWWDYMSSIEEVMDSLHILVQQGKVLYLGVSDTPAWVVSAANYYATSHGKTPFSVYQGKWNVLNRDFERDIIPMARHFGMALAPWDVMG 239          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: KCAB1_RAT (Voltage-gated potassium channel subunit beta-1 OS=Rattus norvegicus GN=Kcnab1 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 6.301e-18
Identity = 64/211 (30.33%), Postives = 107/211 (50.71%), Query Frame = 3
Query:   54 LGTQGLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQ--LPREKILVATKFGIAGIGDTDIIVKG-SPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVH------PIAAVQMEWSLWTRD-IEEDIIPLCRELGIGIXPFSPL 656
            LG  GL VS LG G     GG    +S+E    ++  A+  G+  FDTA+VY     EV+LG  +K+    R  +++ TK    G  +T+   +G S  ++    + SL+RL ++Y+D+ + +R D +  +EE +  M  ++ +G   Y G S  S   I  A++V       P    Q E+ L+ R+ +E  +  L  ++G+G   +SPL
Sbjct:   76 LGKSGLRVSCLGLGTWVTFGGQ---ISDEVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETE---RGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPL 280          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: KCAB1_MUSPU (Voltage-gated potassium channel subunit beta-1 OS=Mustela putorius GN=KCNAB1 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 6.301e-18
Identity = 64/211 (30.33%), Postives = 107/211 (50.71%), Query Frame = 3
Query:   54 LGTQGLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQ--LPREKILVATKFGIAGIGDTDIIVKG-SPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVH------PIAAVQMEWSLWTRD-IEEDIIPLCRELGIGIXPFSPL 656
            LG  GL VS LG G     GG    +S+E    ++  A+  G+  FDTA+VY     EV+LG  +K+    R  +++ TK    G  +T+   +G S  ++    + SL+RL ++Y+D+ + +R D +  +EE +  M  ++ +G   Y G S  S   I  A++V       P    Q E+ L+ R+ +E  +  L  ++G+G   +SPL
Sbjct:   83 LGKSGLRVSCLGLGTWVTFGGQ---ISDEVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETE---RGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPL 287          
The following BLAST results are available for this feature:
BLAST of FC868861 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
KCAB1_RABIT1.658e-1830.09Voltage-gated potassium channel subunit beta-1 OS=... [more]
KCAB1_HUMAN1.658e-1830.09Voltage-gated potassium channel subunit beta-1 OS=... [more]
KCAB1_CHICK1.658e-1831.28Voltage-gated potassium channel subunit beta-1 OS=... [more]
KCAB2_HUMAN2.166e-1830.70Voltage-gated potassium channel subunit beta-2 OS=... [more]
KCAB2_BOVIN2.166e-1830.70Voltage-gated potassium channel subunit beta-2 OS=... [more]
KCAB2_RAT2.829e-1830.70Voltage-gated potassium channel subunit beta-2 OS=... [more]
KCAB2_MOUSE2.829e-1830.70Voltage-gated potassium channel subunit beta-2 OS=... [more]
AAD14_YEAST4.825e-1828.32Putative aryl-alcohol dehydrogenase AAD14 OS=Sacch... [more]
KCAB1_RAT6.301e-1830.33Voltage-gated potassium channel subunit beta-1 OS=... [more]
KCAB1_MUSPU6.301e-1830.33Voltage-gated potassium channel subunit beta-1 OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31005G03EF AbioticL1 Citrus clementina cDNA clone C31005G03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868861 ID=FC868861|Name=FC868861|organism=Citrus clementina|type=EST|length=659bp
AAACAACTTCCTCAAATATGGCAGAAGAGAAACTCCAAGTTCCAAGAGTG
AAACTGGGTACCCAAGGCCTTGAGGTTTCAAAATTGGGTTTTGGATGCAT
GAACCTGAGCGGAGGTTATAGCTCTCCAGTCTCAGAAGAGGACGGCATAA
CAATGATAAAGCATGCTTTCAGTAAAGGAATCACTTTCTTTGATACTGCT
GATGTTTACGGACAAAATGCTAATGAAGTTCTTCTTGGAAAGGCCTTGAA
GCAGTTGCCTAGAGAAAAGATACTAGTAGCAACGAAGTTTGGGATTGCAG
GAATAGGAGATACTGATATCATCGTGAAGGGTTCCCCTGATTATGTGCGC
TCGTGTTGTGAAGCTAGCTTGAAGCGTCTTGATGTGGATTACATTGATCT
ATATTATCAACATAGAGTGGACAAATCAGTTGCTATAGAGGAAACGATTG
GTGAAATGAAGAAGCTAGTGGAAGAGGGTAAAATCAAGTACATTGGATTA
TCTGAGGCTAGTCCAGACACAATTAGGAGAGCACATGCTGTTCATCCCAT
TGCAGCTGTACAAATGGAATGGTCCCTCTGGACTCGTGATATTGAGGAAG
ATATAATACCACTTTGCAGGGAACTTGGCATTGGAATAGNTCCATTCAGT
CCTCTTGGT
back to top