FC868861

Overview
NameFC868861
Unique NameFC868861
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length659
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9491 contig Ccv1_Contig9491:89..747. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: KCAB1_MOUSE (Voltage-gated potassium channel subunit beta-1 OS=Mus musculus GN=Kcnab1 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 6.301e-18
Identity = 64/211 (30.33%), Postives = 107/211 (50.71%), Query Frame = 3
Query:   54 LGTQGLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQ--LPREKILVATKFGIAGIGDTDIIVKG-SPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVH------PIAAVQMEWSLWTRD-IEEDIIPLCRELGIGIXPFSPL 656
            LG  GL VS LG G     GG    +S+E    ++  A+  G+  FDTA+VY     EV+LG  +K+    R  +++ TK    G  +T+   +G S  ++    + SL+RL ++Y+D+ + +R D +  +EE +  M  ++ +G   Y G S  S   I  A++V       P    Q E+ L+ R+ +E  +  L  ++G+G   +SPL
Sbjct:   76 LGKSGLRVSCLGLGTWVTFGGQ---ISDEVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETE---RGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPL 280          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: KCAB1_BOVIN (Voltage-gated potassium channel subunit beta-1 OS=Bos taurus GN=KCNAB1 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 6.301e-18
Identity = 64/211 (30.33%), Postives = 107/211 (50.71%), Query Frame = 3
Query:   54 LGTQGLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQ--LPREKILVATKFGIAGIGDTDIIVKG-SPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVH------PIAAVQMEWSLWTRD-IEEDIIPLCRELGIGIXPFSPL 656
            LG  GL VS LG G     GG    +S+E    ++  A+  G+  FDTA+VY     EV+LG  +K+    R  +++ TK    G  +T+   +G S  ++    + SL+RL ++Y+D+ + +R D +  +EE +  M  ++ +G   Y G S  S   I  A++V       P    Q E+ L+ R+ +E  +  L  ++G+G   +SPL
Sbjct:   76 LGKSGLRVSCLGLGTWVTFGGQ---ISDEVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETE---RGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPL 280          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: AAD_PHACH (Aryl-alcohol dehydrogenase [NADP+] OS=Phanerochaete chrysosporium PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 8.230e-18
Identity = 65/233 (27.90%), Postives = 114/233 (48.93%), Query Frame = 3
Query:   42 PRVKLGTQ-------GLEVSKLGFGCMNLSGGYS----SPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLP-REKILVATKFGIA---GIGDTDIIVKGSPDYVRSCCEA-------SLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAH------AVHPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSPL 656
            P  KLG         GL VS +  G M++   +       + +E    ++   ++ G  F DTA+VY    +E  +G+ ++    R++++VATK+ +    G    +I  K    YV +  ++       SL++L   YID++Y H  D +  IEE +  +  LV +GK+ Y+G+S+     + +A+         P    + EW++  RD+E DIIP+C   G+ I P++ L
Sbjct:   10 PPTKLGRHRQLAPGCGLHVSPIQLGAMSIGDKWHPYGMGTMDKEASFKLLDAFYNAGGNFIDTANVYQDETSEEFIGEWMEARGNRDQMVVATKYSLVYKRGASFEEIPQK--TQYVGNSLKSMHISVHDSLRKLRTSYIDIFYVHFWDYTCTIEEVMNGLHNLVAQGKVLYLGVSDTPAWVVSKANNYARMAGKTPFVIYEGEWNITMRDMERDIIPMCIHEGMAIAPWNVL 240          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: KCAB3_XENLA (Voltage-gated potassium channel subunit beta-3 OS=Xenopus laevis GN=kcnab3 PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.833e-17
Identity = 67/211 (31.75%), Postives = 105/211 (49.76%), Query Frame = 3
Query:   54 LGTQGLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLP--REKILVATKFGIAGIGDTDIIVKG-SPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVH------PIAAVQMEWSLWTRD-IEEDIIPLCRELGIGIXPFSPL 656
            LG  GL VS LG G     G   S +S+E    ++  A+  G+  FDTA+VY     E  LGK LK+    R   +V TK    G  +T+   +G S  ++      SL+RL +DY+D+ + +R+D +  +EE +  M  ++ +G   Y G S  S   I  A++V       P    Q E+ L+ R+ +E  +  L  ++G+G   +SPL
Sbjct:   76 LGKSGLRVSCLGLGTWVTFG---SQISDEVAENLMTVAYEHGVNLFDTAEVYAAGRAERTLGKILKKKEWRRSSYVVTTKIYWGGQAETE---RGLSRKHIIEGLRGSLERLQLDYVDIVFANRMDPNSPMEEIVRAMTFVINQGMAMYWGTSRWSAMEIMEAYSVARQFNLIPPVCEQAEYHLFQREKVETQLPELYHKIGVGSMTWSPL 280          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: YEZB_SCHPO (Uncharacterized oxidoreductase C3A11.11c OS=Schizosaccharomyces pombe GN=SPAC3A11.11c PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.127e-17
Identity = 67/206 (32.52%), Postives = 109/206 (52.91%), Query Frame = 3
Query:   75 VSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQN---ANEVLLGKALKQLPR--EKILVATKFGIAGIGDTDII-VKGSPDYVRSCCEASLKRL-----DVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPIAAVQMEWSLWTRDIE-EDIIPLCRELGIGIXPFSPL 656
            V  +G G  +L+    +PV +E+   ++ +A S G +F+D  + YG +   AN  LL +  ++ P   +K+ ++ K    G  D +   V G+    R C   S+K +      V  IDLY    +D    IEET+  +K+ V+ G I+ IGL E S + I+RAH+V  IAA+++ +S+  R+IE   +  LC +L I +   SPL
Sbjct:    9 VGPIGLGLKSLTWT-ENPVPDEEAFRIMNYALSHGCSFWDAGEFYGLSEPLANLQLLSRYFQKFPDSIDKVFLSVK----GAFDPETHRVHGT----RECITKSIKTVRETLKKVKTIDLYQCAAIDPDTPIEETMACLKEFVDSGDIRCIGLCEPSVEEIKRAHSVVRIAAIEVHYSMLFREIEYNGVKKLCHDLSIPLVAHSPL 205          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: YGHZ_ECO57 (Uncharacterized protein yghZ OS=Escherichia coli O157:H7 GN=yghZ PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.188e-16
Identity = 62/217 (28.57%), Postives = 111/217 (51.15%), Query Frame = 3
Query:   57 GTQGLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQ--NANEVLLGKALKQ---LPREKILVATKFGIA------GIGDTDIIVKGSPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPD-TIRRAHAVH----PIAAVQMEWSLWTRDIEED-IIPLCRELGIGIXPFSPL 656
            G  GL +  L  G  +  G  ++  S+     +++ AF  GIT FD A+ YG    + E   G+ L++     R++++++TK G        G G       GS  Y+ +  + SLKR+ ++Y+D++Y HRVD++  +EET   +   V+ GK  Y+G+S  SP+ T +    +H    P+   Q  ++L  R +++  ++   +  G+G   F+PL
Sbjct:   19 GKSGLRLPALSLGLWHNFGHVNALESQR---AILRKAFDLGITHFDLANNYGPPPGSAEENFGRLLREDFAAYRDELIISTKAGYDMWPGPYGSG-------GSRKYLLASLDQSLKRMGLEYVDIFYSHRVDENTPMEETASALAHAVQSGKALYVGISSYSPERTQKMVELLHEWKIPLLIHQPSYNLLNRWVDKSGLLDTLQNNGVGCIAFTPL 225          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: YEAE_ECOLI (Uncharacterized protein yeaE OS=Escherichia coli (strain K12) GN=yeaE PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.552e-16
Identity = 56/173 (32.37%), Postives = 91/173 (52.60%), Query Frame = 3
Query:  147 ITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKILVATKFGIAGIGDTDIIVKGSPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSE---ASPDTIRRAHAVHPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSPL 656
            +  ++     G+T  DTA++Y     E ++G+AL  L REK+ + +K      G    I         + CEASL+RL+ DY+DLY  H    S A EET+  M+KL+ +GKI+  G+S    A    + +    +  A  Q+ + L +R IE D++P C++  + +  +SPL
Sbjct:   35 VAALRAGIELGLTLIDTAEMYADGGAEKVVGEALTGL-REKVFLVSKVYPWNAGGQKAI---------NACEASLRRLNTDYLDLYLLH-WSGSFAFEETVAAMEKLIAQGKIRRWGVSNLDYADMQELWQLPGGNQCATNQVLYHLGSRGIEYDLLPWCQQQQMPVMAYSPL 196          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: AAD4_YEAST (Probable aryl-alcohol dehydrogenase AAD4 OS=Saccharomyces cerevisiae GN=AAD4 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.647e-16
Identity = 54/194 (27.84%), Postives = 93/194 (47.94%), Query Frame = 3
Query:  129 VSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLP-REKILVATKFGIAGIGDTDIIVKGSPDYVRSC----------CEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRA------HAVHPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSPLG 659
            +++E    ++   +  G    DTA+ Y    +E+ +G+ +K    R++I++ATKF     GD      G       C             SL++L  D+ID+ Y H  D   +IEE +  +  LV++GK+ Y+G+S+     +  A      H   P +  Q +W++  RD E DIIP+ R  G+ + P+  +G
Sbjct:    4 MNKEQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMKSRKLRDQIVIATKF----TGDYKKYEVGGGKSANYCGNHKHSLHVSVRDSLRKLQTDWIDILYVHWWDYMSSIEEVMDSLHILVQQGKVLYLGVSDTPAWVVSAANYYATSHGKTPFSIYQGKWNVLNRDFERDIIPMARHFGMALAPWDVMG 193          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: YGHZ_ECOLI (Uncharacterized protein yghZ OS=Escherichia coli (strain K12) GN=yghZ PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 5.898e-16
Identity = 60/217 (27.65%), Postives = 110/217 (50.69%), Query Frame = 3
Query:   57 GTQGLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQ--NANEVLLGKALKQ---LPREKILVATKFGIA------GIGDTDIIVKGSPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAV-----HPIAAVQMEWSLWTRDIEED-IIPLCRELGIGIXPFSPL 656
            G  GL +  L  G  +  G  ++  S+     +++ AF  GIT FD A+ YG    + E   G+ L++     R++++++TK G        G G       GS  Y+ +  + SLKR+ ++Y+D++Y HRVD++  +EET   +   V+ GK  Y+G+S  SP+  ++   +      P+   Q  ++L  R +++  ++   +  G+G   F+PL
Sbjct:   19 GKSGLRLPALSLGLWHNFGHVNALESQR---AILRKAFDLGITHFDLANNYGPPPGSAEENFGRLLREDFAAYRDELIISTKAGYDMWPGPYGSG-------GSRKYLLASLDQSLKRMGLEYVDIFYSHRVDENTPMEETASALAHAVQSGKALYVGISSYSPERTQKMVELLREWKIPLLIHQPSYNLLNRWVDKSGLLDTLQNNGVGCIAFTPL 225          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: YP088_YEAST (Putative aryl-alcohol dehydrogenase YPL088W OS=Saccharomyces cerevisiae GN=YPL088W PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 4.993e-15
Identity = 63/232 (27.16%), Postives = 109/232 (46.98%), Query Frame = 3
Query:   39 VPRVKLGTQGLEVSKLGFGCMNLSGGYSSPVSEEDG---ITMIKHAFSKGITFFDTADVYGQNANEVLLGKALK--QLPREKILVATK--------------FGIAGIGDTDIIVKG--SPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSE------ASPDTIRRAHAVHPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSP 653
            V +V+LG  GL++S +  GCM+      +    ED      ++KH + KG+  FDTAD Y    +E ++ + L+   + RE +++ TK              F +    + D+  +   S  ++ +  E S+KRL   YIDL   HR+D    ++E +  +  +VE G ++YIG S       A        +      + Q  ++L  R+ E ++IP  +   IG+ P+SP
Sbjct:    4 VKQVRLGNSGLKISPIVIGCMSYGSKKWADWVIEDKTQIFKIMKHCYDKGLRTFDTADFYSNGLSERIIKEFLEYYSIKRETVVIMTKIYFPVDETLDLHHNFTLNEFEELDLSNQRGLSRKHIIAGVENSVKRLGT-YIDLLQIHRLDHETPMKEIMKALNDVVEAGHVRYIGASSMLATEFAELQFTADKYGWFQFISSQSYYNLLYREDERELIPFAKRHNIGLLPWSP 234          
The following BLAST results are available for this feature:
BLAST of FC868861 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
KCAB1_MOUSE6.301e-1830.33Voltage-gated potassium channel subunit beta-1 OS=... [more]
KCAB1_BOVIN6.301e-1830.33Voltage-gated potassium channel subunit beta-1 OS=... [more]
AAD_PHACH8.230e-1827.90Aryl-alcohol dehydrogenase [NADP+] OS=Phanerochaet... [more]
KCAB3_XENLA1.833e-1731.75Voltage-gated potassium channel subunit beta-3 OS=... [more]
YEZB_SCHPO3.127e-1732.52Uncharacterized oxidoreductase C3A11.11c OS=Schizo... [more]
YGHZ_ECO571.188e-1628.57Uncharacterized protein yghZ OS=Escherichia coli O... [more]
YEAE_ECOLI1.552e-1632.37Uncharacterized protein yeaE OS=Escherichia coli (... [more]
AAD4_YEAST2.647e-1627.84Probable aryl-alcohol dehydrogenase AAD4 OS=Saccha... [more]
YGHZ_ECOLI5.898e-1627.65Uncharacterized protein yghZ OS=Escherichia coli (... [more]
YP088_YEAST4.993e-1527.16Putative aryl-alcohol dehydrogenase YPL088W OS=Sac... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31005G03EF AbioticL1 Citrus clementina cDNA clone C31005G03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868861 ID=FC868861|Name=FC868861|organism=Citrus clementina|type=EST|length=659bp
AAACAACTTCCTCAAATATGGCAGAAGAGAAACTCCAAGTTCCAAGAGTG
AAACTGGGTACCCAAGGCCTTGAGGTTTCAAAATTGGGTTTTGGATGCAT
GAACCTGAGCGGAGGTTATAGCTCTCCAGTCTCAGAAGAGGACGGCATAA
CAATGATAAAGCATGCTTTCAGTAAAGGAATCACTTTCTTTGATACTGCT
GATGTTTACGGACAAAATGCTAATGAAGTTCTTCTTGGAAAGGCCTTGAA
GCAGTTGCCTAGAGAAAAGATACTAGTAGCAACGAAGTTTGGGATTGCAG
GAATAGGAGATACTGATATCATCGTGAAGGGTTCCCCTGATTATGTGCGC
TCGTGTTGTGAAGCTAGCTTGAAGCGTCTTGATGTGGATTACATTGATCT
ATATTATCAACATAGAGTGGACAAATCAGTTGCTATAGAGGAAACGATTG
GTGAAATGAAGAAGCTAGTGGAAGAGGGTAAAATCAAGTACATTGGATTA
TCTGAGGCTAGTCCAGACACAATTAGGAGAGCACATGCTGTTCATCCCAT
TGCAGCTGTACAAATGGAATGGTCCCTCTGGACTCGTGATATTGAGGAAG
ATATAATACCACTTTGCAGGGAACTTGGCATTGGAATAGNTCCATTCAGT
CCTCTTGGT
back to top