FC868861

Overview
NameFC868861
Unique NameFC868861
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length659
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9491 contig Ccv1_Contig9491:89..747. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: KCAB3_RAT (Voltage-gated potassium channel subunit beta-3 OS=Rattus norvegicus GN=Kcnab3 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 8.517e-15
Identity = 64/211 (30.33%), Postives = 100/211 (47.39%), Query Frame = 3
Query:   54 LGTQGLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQ--LPREKILVATKFGIAGIGDTDIIVKG-SPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVH------PIAAVQMEWSLWTRD-IEEDIIPLCRELGIGIXPFSPL 656
            LG  GL VS LG G     G   S  + ED +T+   A+  G+  FDTA+VY     E  LG  LK     R   ++ TK    G  +T+   +G S  ++    + SL RL ++Y+D+ + +R D S  +EE +  M  ++ +G   Y G S  S   I  A+++       P    Q E   + R+ +E  +  L  ++G+G   +SPL
Sbjct:   83 LGKSGLRVSCLGLGTWVTFGSQISDETAEDLLTV---AYEHGVNLFDTAEVYAAGKAERTLGNILKSKGWRRSSYVITTKIFWGGQAETE---RGLSRKHIIEGLQGSLDRLQLEYVDIVFANRSDPSSPMEEIVRAMTYVINQGLALYWGTSRWSAAEIMEAYSMARQFNLIPPVCEQAENHFFQREKVEMQLPELYHKIGVGSVTWSPL 287          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: YDBC_ECOLI (Putative oxidoreductase ydbC OS=Escherichia coli (strain K12) GN=ydbC PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.478e-14
Identity = 56/210 (26.67%), Postives = 102/210 (48.57%), Query Frame = 3
Query:   54 LGTQGLEVSKLGFGCMNLSGG--YSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKILVATKFGIAGIGDTDIIVKGSPDYVRSCCEASLKRLDVDYIDLYYQHRV------DKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSPLG 659
            LGT+   V++LG+G M L+G   +  P      IT+++ A + G+   DT+D YG +    ++ +AL     + + + TK G     D   +   SP  ++     +L+ L +D +D+     +          +IE ++  + ++ ++G +K+IGLS  +P  +  A  +  I  VQ E+++  R  +  I  L  + GI   PF PLG
Sbjct:    8 LGTKS--VNRLGYGAMQLAGPGVFGPPRDRHVAITVLREALALGVNHIDTSDFYGPHVTNQIIREALYPY-SDDLTIVTKIGARRGEDASWLPAFSPAELQKAVHDNLRNLGLDVLDVVNLRVMMGDGHGPAEGSIEASLTVLAEMQQQGLVKHIGLSNVTPTQVAEARKIAEIVCVQNEYNIAHRADDAMIDALAHD-GIAYVPFFPLG 213          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: AAD3_YEAST (Putative aryl-alcohol dehydrogenase AAD3 OS=Saccharomyces cerevisiae GN=AAD3 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.236e-14
Identity = 60/233 (25.75%), Postives = 109/233 (46.78%), Query Frame = 3
Query:    9 SSNMAEEKLQVPRVKLGTQGLEVSKLGFGCMNLSGGYSS---PVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLP-REKILVATKF------GIAGIGDTDIIVKGSPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRA------HAVHPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSPLG 659
            S++ +  KL   R    T  ++VS L  G ++  G  S     +++     ++   +  G  F D A+      +E  +G+ ++    R++I++ATKF        AG  +T          +      SL++L  D+ID+ Y H  D   +IEE +  +  LV++GK+ Y+G+S+     +  A      +   P +  Q +W++  RD E DIIP+ R  G+ + P+  +G
Sbjct:    4 SASDSSSKLGRLRFLSETAAIKVSPLILGEVSYDGARSDFLKSMNKNRAFELLDTFYEAGGNFIDAANNCQNEQSEEWIGEWIQSRRLRDQIVIATKFIKSDKKYKAGESNTANYCGNHKRSLHVSVRDSLRKLQTDWIDILYVHWWDYMSSIEEFMDSLHILVQQGKVLYLGVSDTPAWVVSAANYYATSYGKTPFSIYQGKWNVLNRDFERDIIPMARHFGMALAPWDVMG 236          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: KCAB3_HUMAN (Voltage-gated potassium channel subunit beta-3 OS=Homo sapiens GN=KCNAB3 PE=1 SV=2)

HSP 1 Score: 77.411 bits (189), Expect = 7.210e-14
Identity = 62/211 (29.38%), Postives = 98/211 (46.45%), Query Frame = 3
Query:   54 LGTQGLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQ--LPREKILVATKFGIAGIGDTDIIVKG-SPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVH------PIAAVQMEWSLWTRD-IEEDIIPLCRELGIGIXPFSPL 656
            LG  GL VS LG G     G   S  + ED +T+   A+  G+  FDTA+VY     E  LG  LK     R   ++ TK    G  +T+   +G S  ++      SL+RL + Y+D+ + +R D +  +EE +  M  ++ +G   Y G S      I  A+++       P    Q E  L+ R+ +E  +  L  ++G+G   + PL
Sbjct:   83 LGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTV---AYEHGVNLFDTAEVYAAGKAERTLGNILKSKGWRRSSYVITTKIFWGGQAETE---RGLSRKHIIEGLRGSLERLQLGYVDIVFANRSDPNCPMEEIVRAMTYVINQGLALYWGTSRWGAAEIMEAYSMARQFNLIPPVCEQAEHHLFQREKVEMQLPELYHKIGVGSVTWYPL 287          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: AAD10_YEAST (Putative aryl-alcohol dehydrogenase AAD10 OS=Saccharomyces cerevisiae GN=AAD10 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 7.971e-13
Identity = 43/145 (29.66%), Postives = 72/145 (49.66%), Query Frame = 3
Query:  261 REKILVATKFGI------AGIGDTDIIVKGSPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRA------HAVHPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSPLG 659
            R++I++ATKF         G G +          +      SL++L  D+ID+ Y H  D   +IEE +  +  LV++GK+ Y+G+S+     +  A      H   P +  Q +W++  RD E DIIP+ R  G+ + P+  +G
Sbjct:    7 RDQIVIATKFTTDYKGYDVGKGKSANFCGNHKRSLHVSVRDSLRKLQTDWIDILYVHWWDYMSSIEEVMDSLHILVQQGKVLYLGVSDTPAWVVSAANYYATSHGKTPFSIYQGKWNVLNRDFERDIIPMARHFGMALAPWDVMG 151          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: Y2320_MYCBO (Uncharacterized oxidoreductase Mb2320 OS=Mycobacterium bovis GN=Mb2320 PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.360e-12
Identity = 55/200 (27.50%), Postives = 94/200 (47.00%), Query Frame = 3
Query:   72 EVSKLGFGCMNLSG---GYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKILVATKFGIAGIGDTDIIVKGSPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAV--HPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSPL 656
            +VS++G G         GY    +      ++K A + G+T FDTA++YG   +E +LG+AL     E ++ +  F +A            P  +++   AS +RL ++ I LY  H+ +  V     +  M+ L++ G I   G+S  S    R+A A    P+ + Q+ +SL   D  ED++P        +  +SPL
Sbjct:   11 QVSRIGLGTWQFGSREWGYGDRYATGAARDIVKRARALGVTLFDTAEIYGLGKSERILGEALGDDRTEVVVASKVFPVAPF----------PAVIKNRERASARRLQLNRIPLYQIHQPNPVVPDSVIMPGMRDLLDSGDIGAAGVSNYSLARWRKADAALGRPVVSNQVHFSLAHPDALEDLVPFAELENRIVIAYSPL 200          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: Y2298_MYCTU (Uncharacterized oxidoreductase Rv2298/MT2355 OS=Mycobacterium tuberculosis GN=Rv2298 PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.360e-12
Identity = 55/200 (27.50%), Postives = 94/200 (47.00%), Query Frame = 3
Query:   72 EVSKLGFGCMNLSG---GYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKILVATKFGIAGIGDTDIIVKGSPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAV--HPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSPL 656
            +VS++G G         GY    +      ++K A + G+T FDTA++YG   +E +LG+AL     E ++ +  F +A            P  +++   AS +RL ++ I LY  H+ +  V     +  M+ L++ G I   G+S  S    R+A A    P+ + Q+ +SL   D  ED++P        +  +SPL
Sbjct:   11 QVSRIGLGTWQFGSREWGYGDRYATGAARDIVKRARALGVTLFDTAEIYGLGKSERILGEALGDDRTEVVVASKVFPVAPF----------PAVIKNRERASARRLQLNRIPLYQIHQPNPVVPDSVIMPGMRDLLDSGDIGAAGVSNYSLARWRKADAALGRPVVSNQVHFSLAHPDALEDLVPFAELENRIVIAYSPL 200          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: ARK74_HUMAN (Aflatoxin B1 aldehyde reductase member 4 OS=Homo sapiens GN=AKR7L PE=2 SV=5)

HSP 1 Score: 71.633 bits (174), Expect = 3.956e-12
Identity = 59/197 (29.95%), Postives = 91/197 (46.19%), Query Frame = 3
Query:   93 GCMNLSGGYSSPVSEEDGITMIKHAF-SKGITFFDTADVYGQNANEVLLGKALKQLPRE--KILVATKFGIAGIGDTDIIVKGSPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSE------ASPDTIRRAHAVHPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSPL 656
            G M +     +P S       +  AF  +G T  DTA +Y    +E +LG    ++     ++ +ATK     IG++       PD VRS  E SLKRL    +DL+Y H  D S  +EET+    +L +EGK   +GLS       A   T+ +++        Q  +S  TR +E ++ P  R  G+    ++PL
Sbjct:   15 GAMEMGRRMDAPTS-----AAVTRAFLERGHTEIDTAFLYSDGQSETILGGLGLRMGSSDCRVKIATKAN-PWIGNSL-----KPDSVRSQLETSLKRLQCPUVDLFYLHAPDHSAPVEETLRACHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYSATTRQVETELFPCLRHFGLRFYAYNPL 200          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: TAS_SHIFL (Protein tas OS=Shigella flexneri GN=tas PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.503e-11
Identity = 64/231 (27.71%), Postives = 101/231 (43.72%), Query Frame = 3
Query:   69 LEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYG-------QNANEVLLGKAL-KQLPREKILVATKF-GIAGIGDTDIIVKGSPDY--VRSCCEASLKRLDVDYIDLYYQHRVDK-----------------SVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRR------AHAVHPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSPLG 659
            LEVS LG G M     +    SE D    + +A ++GI   D A++Y        Q   E  +G  L K   REK+++A+K  G +   D  I    + D   +R     SLKRL  DY+DLY  H   +                 +V++ +T+  + +    GKI+YIG+S  +   + R       H +  I  +Q  +SL  R  E  +  + +  G+ +  +S LG
Sbjct:   11 LEVSTLGLGTMT----FGEQNSEADAHAQLDYAVAQGINLIDVAEMYPVPPRPETQGLTETYVGNWLAKHGSREKLIIASKVSGPSRNNDKGIRPDQALDRKNIREALHDSLKRLQTDYLDLYQVHWPQRPTNCFGKLGYSWTDSAPAVSLLDTLDALAEYQRAGKIRYIGVSNETAFGVMRYLHLADKHDLPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLG 237          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: TAS_ECOLI (Protein tas OS=Escherichia coli (strain K12) GN=tas PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.503e-11
Identity = 64/231 (27.71%), Postives = 101/231 (43.72%), Query Frame = 3
Query:   69 LEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYG-------QNANEVLLGKAL-KQLPREKILVATKF-GIAGIGDTDIIVKGSPDY--VRSCCEASLKRLDVDYIDLYYQHRVDK-----------------SVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRR------AHAVHPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSPLG 659
            LEVS LG G M     +    SE D    + +A ++GI   D A++Y        Q   E  +G  L K   REK+++A+K  G +   D  I    + D   +R     SLKRL  DY+DLY  H   +                 +V++ +T+  + +    GKI+YIG+S  +   + R       H +  I  +Q  +SL  R  E  +  + +  G+ +  +S LG
Sbjct:   11 LEVSTLGLGTMT----FGEQNSEADAHAQLDYAVAQGINLIDVAEMYPVPPRPETQGLTETYVGNWLAKHGSREKLIIASKVSGPSRNNDKGIRPDQALDRKNIREALHDSLKRLQTDYLDLYQVHWPQRPTNCFGKLGYSWTDSAPAVSLLDTLDALAEYQRAGKIRYIGVSNETAFGVMRYLHLADKHDLPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLG 237          
The following BLAST results are available for this feature:
BLAST of FC868861 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
KCAB3_RAT8.517e-1530.33Voltage-gated potassium channel subunit beta-3 OS=... [more]
YDBC_ECOLI2.478e-1426.67Putative oxidoreductase ydbC OS=Escherichia coli (... [more]
AAD3_YEAST3.236e-1425.75Putative aryl-alcohol dehydrogenase AAD3 OS=Saccha... [more]
KCAB3_HUMAN7.210e-1429.38Voltage-gated potassium channel subunit beta-3 OS=... [more]
AAD10_YEAST7.971e-1329.66Putative aryl-alcohol dehydrogenase AAD10 OS=Sacch... [more]
Y2320_MYCBO1.360e-1227.50Uncharacterized oxidoreductase Mb2320 OS=Mycobacte... [more]
Y2298_MYCTU1.360e-1227.50Uncharacterized oxidoreductase Rv2298/MT2355 OS=My... [more]
ARK74_HUMAN3.956e-1229.95Aflatoxin B1 aldehyde reductase member 4 OS=Homo s... [more]
TAS_SHIFL1.503e-1127.71Protein tas OS=Shigella flexneri GN=tas PE=3 SV=1[more]
TAS_ECOLI1.503e-1127.71Protein tas OS=Escherichia coli (strain K12) GN=ta... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31005G03EF AbioticL1 Citrus clementina cDNA clone C31005G03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868861 ID=FC868861|Name=FC868861|organism=Citrus clementina|type=EST|length=659bp
AAACAACTTCCTCAAATATGGCAGAAGAGAAACTCCAAGTTCCAAGAGTG
AAACTGGGTACCCAAGGCCTTGAGGTTTCAAAATTGGGTTTTGGATGCAT
GAACCTGAGCGGAGGTTATAGCTCTCCAGTCTCAGAAGAGGACGGCATAA
CAATGATAAAGCATGCTTTCAGTAAAGGAATCACTTTCTTTGATACTGCT
GATGTTTACGGACAAAATGCTAATGAAGTTCTTCTTGGAAAGGCCTTGAA
GCAGTTGCCTAGAGAAAAGATACTAGTAGCAACGAAGTTTGGGATTGCAG
GAATAGGAGATACTGATATCATCGTGAAGGGTTCCCCTGATTATGTGCGC
TCGTGTTGTGAAGCTAGCTTGAAGCGTCTTGATGTGGATTACATTGATCT
ATATTATCAACATAGAGTGGACAAATCAGTTGCTATAGAGGAAACGATTG
GTGAAATGAAGAAGCTAGTGGAAGAGGGTAAAATCAAGTACATTGGATTA
TCTGAGGCTAGTCCAGACACAATTAGGAGAGCACATGCTGTTCATCCCAT
TGCAGCTGTACAAATGGAATGGTCCCTCTGGACTCGTGATATTGAGGAAG
ATATAATACCACTTTGCAGGGAACTTGGCATTGGAATAGNTCCATTCAGT
CCTCTTGGT
back to top