FC868976

Overview
NameFC868976
Unique NameFC868976
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length712
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALF_CICAR (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Cicer arietinum GN=ALDC PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.402e-38
Identity = 79/127 (62.20%), Postives = 93/127 (73.23%), Query Frame = 3
Query:  237 YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYY 617
            Y DEL+  A  + +PG+GILA DES  T GKRLASI +EN E NR+A R LL TAP + QY+SG ILFEETLYQST  GK  VDVL E  ++PGIKVDKG V LAG++ E+  QGLDGL +R A YY
Sbjct:    8 YHDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLFTAPNVLQYLSGVILFEETLYQSTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCAKYY 134          

HSP 2 Score: 25.7942 bits (55), Expect = 1.402e-38
Identity = 10/13 (76.92%), Postives = 11/13 (84.62%), Query Frame = 2
Query:  623 GARFAKWRTVVSI 661
            GARFAKWR V+ I
Sbjct:  137 GARFAKWRAVLKI 149          
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALF_SPIOL (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.403e-38
Identity = 78/134 (58.21%), Postives = 93/134 (69.40%), Query Frame = 3
Query:  216 LTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYY 617
            +T   G YADEL+  A  +A+PG+ ILA DES  T GKR  SI +EN E+NR+A R LL T PG   Y+SG ILFEETLYQ T DGK  VD + +  ++PGIKVDKG V LAG+N E+  QGLDGLA R A YY
Sbjct:    1 MTAYRGKYADELIANASYIATPGKVILAADESTGTIGKRFPSINVENVESNRRALRELLFTTPGALPYLSGVILFEETLYQKTADGKPFVDAMKDGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCAQYY 134          

HSP 2 Score: 25.7942 bits (55), Expect = 1.403e-38
Identity = 10/13 (76.92%), Postives = 11/13 (84.62%), Query Frame = 2
Query:  623 GARFAKWRTVVSI 661
            GARFAKWR V+ I
Sbjct:  137 GARFAKWRAVLKI 149          
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALF_MAIZE (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Zea mays PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 7.411e-37
Identity = 75/129 (58.14%), Postives = 89/129 (68.99%), Query Frame = 3
Query:  231 GSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYY 617
            G Y DEL+K A  + +PG+GILA DES  T GKRL+SI +EN E NR+A R LL   PG  QYISG ILFEETLYQ T DGK  VDVL E  ++PGIKVDKG + + G++ E+  QG D L  R A YY
Sbjct:    6 GKYKDELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLFCCPGALQYISGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVVGTDKETTTQGHDDLGKRCAKYY 134          

HSP 2 Score: 25.7942 bits (55), Expect = 7.411e-37
Identity = 10/13 (76.92%), Postives = 11/13 (84.62%), Query Frame = 2
Query:  623 GARFAKWRTVVSI 661
            GARFAKWR V+ I
Sbjct:  137 GARFAKWRAVLKI 149          
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALF_ORYSJ (Fructose-bisphosphate aldolase cytoplasmic isozyme OS=Oryza sativa subsp. japonica GN=FBA PE=1 SV=2)

HSP 1 Score: 148.288 bits (373), Expect = 1.638e-36
Identity = 74/129 (57.36%), Postives = 88/129 (68.22%), Query Frame = 3
Query:  231 GSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYY 617
            G Y DEL+K A  + +PG+GILA DES  T GKR ASI +EN E NR++ R LL   PG  QY+SG ILFEETLYQ T DGK  VDVL E  ++PGIKVDKG + +AG+  E+  QG D L  R A YY
Sbjct:    6 GKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLFCTPGALQYLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVAGTEKETTTQGHDDLGKRCAKYY 134          

HSP 2 Score: 25.7942 bits (55), Expect = 1.638e-36
Identity = 10/13 (76.92%), Postives = 11/13 (84.62%), Query Frame = 2
Query:  623 GARFAKWRTVVSI 661
            GARFAKWR V+ I
Sbjct:  137 GARFAKWRAVLKI 149          
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALF2_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 2 OS=Pisum sativum PE=3 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 1.042e-35
Identity = 77/128 (60.16%), Postives = 91/128 (71.09%), Query Frame = 3
Query:  237 YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLG-QYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYY 617
            Y DEL+  A  + +PG+GILA DES  T GKRL+SI +EN E+NRQA R LL TA  L  QY+SG ILFEETLYQ T  GK  VDVL E  ++PGIKVDKG V LAG++ E+  QGLDGL +R   YY
Sbjct:    8 YHDELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRQALRELLFTASWLFLQYLSGVILFEETLYQKTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCRKYY 135          

HSP 2 Score: 25.7942 bits (55), Expect = 1.042e-35
Identity = 10/13 (76.92%), Postives = 11/13 (84.62%), Query Frame = 2
Query:  623 GARFAKWRTVVSI 661
            GARFAKWR V+ I
Sbjct:  138 GARFAKWRAVLKI 150          
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALF_DICDI (Fructose-bisphosphate aldolase OS=Dictyostelium discoideum GN=fba PE=3 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 6.633e-35
Identity = 72/128 (56.25%), Postives = 89/128 (69.53%), Query Frame = 3
Query:  237 YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLV-TAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYY 617
            +ADEL+ TAK + +PG+GILA DES  T G R   I LEN E NR+AYR LL+ T  G+ ++I G IL+EETLYQ   DG+   DVL EQ I  GIKVDKG+VP+ G++ E+  QGLDGLA R   YY
Sbjct:    5 FADELIATAKAIVAPGKGILAADESTNTIGARFKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQKMADGRLFTDVLREQKIHIGIKVDKGVVPIPGTDGETSTQGLDGLAERCKKYY 132          

HSP 2 Score: 27.7202 bits (60), Expect = 6.633e-35
Identity = 11/16 (68.75%), Postives = 13/16 (81.25%), Query Frame = 2
Query:  623 GARFAKWRTVVSIPMA 670
            GARFAKWR V+ I +A
Sbjct:  135 GARFAKWRAVLKIDLA 150          
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALF_SCHMA (Fructose-bisphosphate aldolase OS=Schistosoma mansoni PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 7.154e-34
Identity = 72/126 (57.14%), Postives = 95/126 (75.40%), Query Frame = 3
Query:  243 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYY 617
            ++L + A+ + +PG+GILA DES AT GKRL  IG+EN E NR+ YR LL +A   L + ISG ILFEETL+Q + DGK +  +L E+NI+PGIKVDKG+VPLAG+++E+  QGLD LASR A Y+
Sbjct:   14 NDLRRIAQAICAPGKGILAADESTATMGKRLQQIGVENNEENRRLYRQLLFSADHKLAENISGVILFEETLHQKSDDGKTLPTLLAERNIIPGIKVDKGVVPLAGTDNETTTQGLDDLASRCAEYW 139          

HSP 2 Score: 24.6386 bits (52), Expect = 7.154e-34
Identity = 11/19 (57.89%), Postives = 13/19 (68.42%), Query Frame = 2
Query:  623 GARFAKWRTVVSIPMAHLP 679
            G RFAKWR V+ I  +H P
Sbjct:  142 GCRFAKWRCVLKI-SSHTP 159          
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALF1_XANAC (Probable fructose-bisphosphate aldolase class 1 OS=Xanthomonas axonopodis pv. citri GN=XAC3344 PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.583e-33
Identity = 66/125 (52.80%), Postives = 87/125 (69.60%), Query Frame = 3
Query:  243 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYY 617
            ++L +TA+ + +PG+GI+A+DES +T  KR AS+G+EN E NR+AYR LL+T P L  YISGAILF+ET+ Q T DG    + +    I+PGIKVDKG  PLAG   E   +GLDGL +R   YY
Sbjct:    4 EQLAETAQAMVAPGKGIIAIDESTSTIAKRFASVGIENIEENRRAYRELLLTTPKLSDYISGAILFDETIRQKTKDGVPFAEYMTAHGIIPGIKVDKGAQPLAGMPGELVTEGLDGLRARLEEYY 128          

HSP 2 Score: 26.9498 bits (58), Expect = 1.583e-33
Identity = 10/13 (76.92%), Postives = 12/13 (92.31%), Query Frame = 2
Query:  623 GARFAKWRTVVSI 661
            GARFAKWR V++I
Sbjct:  131 GARFAKWRAVINI 143          
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALF1_XANCP (Probable fructose-bisphosphate aldolase class 1 OS=Xanthomonas campestris pv. campestris GN=XCC3185 PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 2.061e-33
Identity = 65/125 (52.00%), Postives = 87/125 (69.60%), Query Frame = 3
Query:  243 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYY 617
            ++L +TA+ + +PG+GI+A+DES +T  KR + +G+ENTE NR+AYR LL+T P L  YISGAILF+ET+ Q T DG      + +  I+PGIKVDKG  PLAG   E   +GLDGL +R   YY
Sbjct:    4 EQLAETAQAMVAPGKGIIAIDESTSTIAKRFSGVGIENTEENRRAYRELLLTTPKLSDYISGAILFDETIRQKTKDGVPFAKYMADHGIIPGIKVDKGAQPLAGMPGELVTEGLDGLRARLEEYY 128          

HSP 2 Score: 26.9498 bits (58), Expect = 2.061e-33
Identity = 10/13 (76.92%), Postives = 12/13 (92.31%), Query Frame = 2
Query:  623 GARFAKWRTVVSI 661
            GARFAKWR V++I
Sbjct:  131 GARFAKWRAVINI 143          
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALF_ECHMU (Fructose-bisphosphate aldolase OS=Echinococcus multilocularis GN=FBPA PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 2.681e-33
Identity = 71/126 (56.35%), Postives = 89/126 (70.63%), Query Frame = 3
Query:  246 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTA-PGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYH 620
            EL + A  + +PG+G+LA DES  T GKR A+I LENTE NR+AYR LL T  P   ++ISG ILF ET+YQ T DGK  V++L E+ ++PGIKVD G+VPL G+ DE   QGLD LA R A YY+
Sbjct:   15 ELRENASAIVAPGKGLLAADESTNTIGKRFAAINLENTEENRRAYRELLFTTDPEFAKHISGVILFHETVYQKTKDGKPFVELLRERGVLPGIKVDLGVVPLGGTADECTTQGLDNLAQRCAQYYN 140          

HSP 2 Score: 23.8682 bits (50), Expect = 2.681e-33
Identity = 9/13 (69.23%), Postives = 10/13 (76.92%), Query Frame = 2
Query:  623 GARFAKWRTVVSI 661
            G RFAKWR V+ I
Sbjct:  142 GCRFAKWRCVLKI 154          
The following BLAST results are available for this feature:
BLAST of FC868976 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALF_CICAR1.402e-3862.20Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_SPIOL1.403e-3858.21Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_MAIZE7.411e-3758.14Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ORYSJ1.638e-3657.36Fructose-bisphosphate aldolase cytoplasmic isozyme... [more]
ALF2_PEA1.042e-3560.16Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_DICDI6.633e-3556.25Fructose-bisphosphate aldolase OS=Dictyostelium di... [more]
ALF_SCHMA7.154e-3457.14Fructose-bisphosphate aldolase OS=Schistosoma mans... [more]
ALF1_XANAC1.583e-3352.80Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALF1_XANCP2.061e-3352.00Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALF_ECHMU2.681e-3356.35Fructose-bisphosphate aldolase OS=Echinococcus mul... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31007B11EF AbioticL1 Citrus clementina cDNA clone C31007B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868976 ID=FC868976; Name=FC868976; organism=Citrus clementina; type=EST; length=712bp
GAAAGATCGTGAAGATAAGATTATAAGTGCTATAAGCTAAGGCCTCTCGA
GCTCAGAACCCACAGCAAGAAGAAGCAAAGAGGAAAATGGCCTCAGCCTC
GGCATCTTTACTCAAGTCATCATCCCCCGTTCTTGACAAGTCTGAGTGGG
TTAAGGGCCAGGCCATCCGCCAGTCTACTGTCTCAGTCCGCAGCCTCCCC
AGTGGCCCCTCTTCCCTCACCATCCGTGCTGGTTCCTATGCCGATGAGCT
TGTCAAGACCGCGAAAACTGTTGCATCACCAGGACGTGGAATTTTGGCCA
TGGATGAGTCAAATGCAACTTGTGGAAAACGCCTTGCCTCAATTGGGTTA
GAGAACACTGAGGCTAACCGCCAGGCATACCGTACCCTCCTTGTTACAGC
CCCTGGTCTTGGACAGTACATCTCTGGTGCCATCCTTTTTGAGGAGACTC
TCTACCAATCCACCACCGATGGCAAGAAGATGGTCGATGTTCTTGTTGAG
CAAAACATTGTCCCCGGTATCAAAGTCGACAAGGGTTTGGTGCCCCTTGC
TGGTTCCAATGATGAGTCATGGTGCCAGGGTCTTGATGGCCTGGCTTCTC
GCACTGCTGCTTACTACCACAGGGAGCTCGTTTCGCCAAATGGCGTACTG
TTGTGAGCATTCCCATGGCCCATCTGCCTTGGCAGTCAAGGAAGCGCCCT
GGGTCTTGCCGC
back to top