FC869089

Overview
NameFC869089
Unique NameFC869089
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length735
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: SCP4_ARATH (Serine carboxypeptidase-like 4 OS=Arabidopsis thaliana GN=SCPL4 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 2.926e-41
Identity = 80/195 (41.03%), Postives = 111/195 (56.92%), Query Frame = 1
Query:  142 MYKILACYTLLSFSVLTHS--APETALIAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVESEGNPSKDPVVLWLNGGPGCSSFDGFIYEHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTDYVTGDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYVPTLAYEVMKG 720
            +Y +L    LL   V          +++  +PGF G LP +  +GY+ V E     LFYYF++SE NP +DP++LWL GGPGCS+  G +Y++GP   +     G+LP L    YSWTK SS+I+LD P G G SYS  +      D   A   H FL KW   + EF +NPF++ G+SY+G+ VP    E+ KG
Sbjct:    6 VYSVLKSLLLLLHLVFLSKQHVDSASIVKFLPGFEGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLTGGPGCSAISGLLYQNGPLAMKLDVYNGTLPSLVSTTYSWTKTSSMIFLDQPVGTGFSYSRTQLFNKPSDTGEAKRIHEFLQKWLGKHQEFSSNPFYVGGDSYSGLVVPATVQEISKG 200          
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: SCP13_ARATH (Serine carboxypeptidase-like 13 OS=Arabidopsis thaliana GN=SCPL13 PE=2 SV=2)

HSP 1 Score: 168.703 bits (426), Expect = 2.926e-41
Identity = 77/184 (41.85%), Postives = 112/184 (60.87%), Query Frame = 1
Query:  169 LLSFSVLTHSAPETALIAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVESEGNPSKDPVVLWLNGGPGCSSFDGFIYEHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTDYVTGDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYVPTLAYEVMKG 720
            LL   +L+H A   +++  +PGF G LP +  +GY+ + E     LFYYF++SE NP +DP++LWL+GGPGCSS  G ++E+GP   +     GS+P L    YSWTK+++II+LD P G G SYS         D       + FL KW   + +F +NPF++ G+SY+G+ VP L  E+ KG
Sbjct:   10 LLIVLILSHHAHSGSIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSEKNPEEDPLLLWLSGGPGCSSLTGLLFENGPVALKFEVYNGSVPSLVSTTYSWTKMANIIFLDQPVGSGFSYSRTPLVDKISDTGEVKRIYEFLQKWLSKHQQFFSNPFYVGGDSYSGMIVPPLVQEIGKG 193          
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: SCP11_ARATH (Serine carboxypeptidase-like 11 OS=Arabidopsis thaliana GN=SCPL11 PE=2 SV=2)

HSP 1 Score: 166.777 bits (421), Expect = 1.112e-40
Identity = 75/184 (40.76%), Postives = 109/184 (59.24%), Query Frame = 1
Query:  169 LLSFSVLTHSAPETALIAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVESEGNPSKDPVVLWLNGGPGCSSFDGFIYEHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTDYVTGDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYVPTLAYEVMKG 720
            +L   +L H     +++  +PGF G LP +  +GY+ + E     LFYYF++SE NP +DP++LWL+GGPGCSS  G ++++GP   ++    GS+P L    YSWTK ++II+LD P G G SYS         D       H FL KW   +P+F +N F+  G+SY+G+ VP L  E+ KG
Sbjct:    9 VLLLFILNHHVGSGSIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSERNPKEDPLLLWLSGGPGCSSITGLLFQNGPLALKSEVYNGSVPSLVSTTYSWTKTANIIFLDQPVGAGFSYSRAPLIDTPTDTGEVKRIHEFLQKWLSKHPQFSSNHFYAGGDSYSGMIVPALVQEISKG 192          
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: NF314_NAEFO (Virulence-related protein Nf314 OS=Naegleria fowleri PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.112e-40
Identity = 79/175 (45.14%), Postives = 111/175 (63.43%), Query Frame = 1
Query:  214 LIAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVESEGNPSKDPVVLWLNGGPGCSSFDGFIYEHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTDYVT-GDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYVPTLAYEVMKGIDAGE 735
            L+ Q+PG SGN+  K Y+GY+  + + GR LFY+F ES  NPS+DP+V+W NGGPGCSS  G   EHG F   A         +  NPYSW +VS+I+Y++ P GVG SYS +  DY    D++ ASD +  L  +   +P+F+    ++AGESY G+YVPT AY +++G   G+
Sbjct:   15 LVTQLPGLSGNIGVKSYTGYLLANATRGRYLFYWFFESMRNPSQDPLVMWTNGGPGCSSLGGEASEHGLFLVNADGA-----TITRNPYSWNRVSNILYIEQPVGVGFSYSNSTDDYQNLNDVQAASDMNNALRDFLTRFPQFIGRETYLAGESYGGVYVPTTAYNIVEGNGKGQ 184          
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: PPGB_MOUSE (Lysosomal protective protein OS=Mus musculus GN=Ctsa PE=1 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.452e-40
Identity = 82/183 (44.81%), Postives = 117/183 (63.93%), Query Frame = 1
Query:  169 LLSFSVLTHSAPETALIAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVESEGNPSKDPVVLWLNGGPGCSSFDGFIYEHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTDYVTGDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYVPTLAYEVMK 717
            LLS++    +AP+   I  +PG +     + YSGY+   +S  ++  Y+FVES+ +P   PVVLWLNGGPGCSS DG + EHGPF  +          L  NPY+W  +++++Y++SPAGVG SYS++K  YVT D + A + +  L  +F L+PE+  N  F+ GESYAGIY+PTLA  VM+
Sbjct:   14 LLSWASRNEAAPDQDEIDCLPGLAKQPSFRQYSGYLRASDS--KHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGV-----TLEYNPYAWNLIANVLYIESPAGVGFSYSDDKM-YVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQ 188          
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: SCP41_ARATH (Serine carboxypeptidase-like 41 OS=Arabidopsis thaliana GN=SCPL41 PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.897e-40
Identity = 84/183 (45.90%), Postives = 116/183 (63.39%), Query Frame = 1
Query:  169 LLSFSVLTHSAPETALIAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVESEGNPSKDPVVLWLNGGPGCSSFDGFIY-EHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTDYVTGDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYVPTLAYEVM 714
            +++  V     PET L+ ++PG    +  + Y+GYV +D + GR+LFYYFVE+E +P   P+ LWLNGGPGCSS  G  + E GPF    PT  G    L +N  SW K S+++++DSPAGVG SYS   +DY  GD   ASD   FLL+WF+ +PE  ++  F+ GESYAG Y+P LA  ++
Sbjct:   13 MVTVQVFARGYPETDLVVRLPG-QPKVVFRQYAGYVDLDLNAGRSLFYYFVEAEKHPDTKPLTLWLNGGPGCSSVGGGAFTELGPFY---PTGYGR--GLRINSMSWNKASNLLFVDSPAGVGWSYSNRSSDYNAGDKSAASDMLVFLLRWFDKFPELKSHDLFLTGESYAGHYIPQLADAIL 189          
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: SCP26_ARATH (Serine carboxypeptidase-like 26 OS=Arabidopsis thaliana GN=SCPL26 PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 4.226e-40
Identity = 87/182 (47.80%), Postives = 115/182 (63.19%), Query Frame = 1
Query:  169 LLSFSVLTHSAPETALIAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVES--EGNPSKDPVVLWLNGGPGCSSFD-GFIYEHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTD-YVTGDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYVPTLA 702
            LL ++  +    E   I  +PG   ++   H+SGY+TV+ES GR LFY+  ES    NP   P+VLWLNGGPGCSS   G   E GPF    P  K     L+ NPYSW K++++++L+SPAGVG SYS   +D Y  GD +TA D + FL+KWFE +P++    F+IAGESYAG YVP L+
Sbjct:   14 LLHYASCSRHEQEKDRIFHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSENPESKPLVLWLNGGPGCSSVAYGAAEEIGPFRIN-PDGK----TLYHNPYSWNKLANLLFLESPAGVGFSYSNTTSDLYTAGDQRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYVPQLS 190          
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: SCP53_ARATH (Putative serine carboxypeptidase-like 53 OS=Arabidopsis thaliana GN=SCPL53 PE=5 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 5.519e-40
Identity = 81/163 (49.69%), Postives = 106/163 (65.03%), Query Frame = 1
Query:  205 ETALIAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVESEGNPSKDPVVLWLNGGPGCSSFDGFIYEHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTDYVT-GDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYV 690
            E  LI  +PG   ++  K Y GYVTV+ES GR+L+YYFVE+    +  P+VLWLNGGPGCSS  G   E GPF   +         L+ NPYSW  V+++++L+SPAG G SY+   TD    GD+KTA+D + FL+KW E +PE+    F+IAGESYAG YV
Sbjct:   76 ERDLIENLPG-QPSVNFKQYGGYVTVNESAGRSLYYYFVEATNTKNSSPLVLWLNGGPGCSSLYGAFQELGPFRVHSDN-----KTLYTNPYSWNNVANMLFLESPAGTGFSYTNTTTDMENPGDMKTAADNYVFLVKWLERFPEYKGRDFYIAGESYAGHYV 232          
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: SCP34_ARATH (Serine carboxypeptidase-like 34 OS=Arabidopsis thaliana GN=SCPL34 PE=2 SV=2)

HSP 1 Score: 164.466 bits (415), Expect = 5.519e-40
Identity = 82/169 (48.52%), Postives = 113/169 (66.86%), Query Frame = 1
Query:  217 IAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVESEGNPSKDPVVLWLNGGPGCSSFD-GFIYEHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTDY-VTGDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYVPTLAYEVMK 717
            + ++PG    +  + Y+GYVTV+E+HGR LFY+F E+  NPSK PV+LWLNGGPGCSS   G   E GPF         S PKL +NPYSW K +++++L+SP GVG SY+    D    GD  TA D++ FL+ WF+ +P++ ++ F+IAGESYAG YVP L+  + K
Sbjct:   52 VKELPG-QPPVKFRQYAGYVTVNETHGRALFYWFFEATQNPSKKPVLLWLNGGPGCSSIGFGAAEELGPFF----PQNSSQPKLKLNPYSWNKAANLLFLESPVGVGFSYTNTSRDIKQLGDTVTARDSYNFLVNWFKRFPQYKSHDFYIAGESYAGHYVPQLSELIYK 215          
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: SCP39_ARATH (Serine carboxypeptidase-like 39 OS=Arabidopsis thaliana GN=SCPL39 PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 7.208e-40
Identity = 82/171 (47.95%), Postives = 109/171 (63.74%), Query Frame = 1
Query:  205 ETALIAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVESEGNPSKDPVVLWLNGGPGCSSFDGFIYEHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTDYVT-GDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYVPTLAYEVM 714
            E  LI  +PG   ++  + Y GYVTV+ES GR+L+YYFVE+       P+VLWLNGGPGCSS  G   E GPF        G    L+ NPYSW  V++I++L+SP G G SY+  ++D    GD+K A+D + FL+KW E +PE+    F+IAGESYAG YVP LA  ++
Sbjct:   76 ERDLIENLPG-QPSVSFRQYGGYVTVNESAGRSLYYYFVEATKTKKSLPLVLWLNGGPGCSSLYGAFQELGPFRI-----YGDGKTLYTNPYSWNNVANILFLESPVGTGFSYTNTESDLENPGDMKAAADKYIFLVKWLERFPEYKGREFYIAGESYAGHYVPQLAQTIL 240          
The following BLAST results are available for this feature:
BLAST of FC869089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 100
Match NameE-valueIdentityDescription
SCP4_ARATH2.926e-4141.03Serine carboxypeptidase-like 4 OS=Arabidopsis thal... [more]
SCP13_ARATH2.926e-4141.85Serine carboxypeptidase-like 13 OS=Arabidopsis tha... [more]
SCP11_ARATH1.112e-4040.76Serine carboxypeptidase-like 11 OS=Arabidopsis tha... [more]
NF314_NAEFO1.112e-4045.14Virulence-related protein Nf314 OS=Naegleria fowle... [more]
PPGB_MOUSE1.452e-4044.81Lysosomal protective protein OS=Mus musculus GN=Ct... [more]
SCP41_ARATH1.897e-4045.90Serine carboxypeptidase-like 41 OS=Arabidopsis tha... [more]
SCP26_ARATH4.226e-4047.80Serine carboxypeptidase-like 26 OS=Arabidopsis tha... [more]
SCP53_ARATH5.519e-4049.69Putative serine carboxypeptidase-like 53 OS=Arabid... [more]
SCP34_ARATH5.519e-4048.52Serine carboxypeptidase-like 34 OS=Arabidopsis tha... [more]
SCP39_ARATH7.208e-4047.95Serine carboxypeptidase-like 39 OS=Arabidopsis tha... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31008D08EF AbioticL1 Citrus clementina cDNA clone C31008D08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869089 ID=FC869089; Name=FC869089; organism=Citrus clementina; type=EST; length=735bp
AGAAAAATATTGGACTGTAATCCACGTTTTTTCAATAGAAACTTGCATTT
TCACCAACTATATAAATGCGTCTCGGGGATCCTCAAACAGTCATGCAGTC
TACTCTAATCAAACTTTTTAATGGGTAAAGGTCGTCTTATCATGTACAAG
ATACTAGCTTGTTACACATTATTGAGCTTTTCAGTGTTGACTCATTCAGC
TCCTGAAACTGCTCTCATCGCTCAGATTCCTGGCTTCTCTGGCAATCTCC
CTTCCAAGCACTATTCTGGGTATGTGACGGTTGATGAAAGCCATGGGAGG
AACCTCTTTTACTACTTTGTTGAATCCGAAGGGAATCCATCCAAGGATCC
TGTGGTTCTGTGGCTCAATGGTGGACCAGGATGCTCCAGCTTTGATGGTT
TTATATATGAGCACGGGCCTTTCAATTTTGAAGCACCAACGACAAAGGGA
AGTCTGCCCAAGTTGCATGTCAATCCATATAGCTGGACCAAGGTTTCTAG
CATTATATATTTAGATTCCCCAGCTGGTGTTGGACTTTCTTACTCAGAAA
ATAAAACTGATTATGTTACTGGGGACTTAAAGACTGCCTCTGATACACAC
ACATTTCTCCTCAAGTGGTTTGAACTATACCCGGAGTTCCTAGCCAACCC
ATTTTTTATTGCTGGAGAGTCATATGCTGGGATATATGTGCCCACTCTTG
CTTATGAAGTGATGAAAGGAATTGATGCTGGTGAA
back to top