FC869089

Overview
NameFC869089
Unique NameFC869089
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length735
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9455 contig Ccv1_Contig9455:1..735. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: YUA6_CAEEL (Uncharacterized serine carboxypeptidase F13S12.6 OS=Caenorhabditis elegans GN=F13D12.6 PE=2 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.170e-36
Identity = 83/193 (43.01%), Postives = 115/193 (59.59%), Query Frame = 1
Query:  136 LIMYKILACYTLLSFSVLTHSAPETALIAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVESEGNPSKDPVVLWLNGGPGCSSFDGFIYEHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTDYVTGDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYVPTLAYEVM 714
            ++M + L    LL F+ +     E+ALI  +PG   +   K YSGY  V       L Y+FVES+ NPS DPV+LWL GGPGCS     + E GP+N     T G+   L  NPYSW K +SI+ L++PAGVG SY+ +  +  TGD +TAS+    L+ +F  +P++  N F++ GESY GIYVPTL   ++
Sbjct:    1 MVMSRTLVLVALLGFAYVC----ESALITNLPGAPIS-NFKQYSGYYNVGTKKNHMLHYWFVESQSNPSTDPVLLWLTGGPGCSGLSALLTEWGPWNV---NTDGA--TLRTNPYSWNKNASILTLEAPAGVGYSYATD-NNIATGDDQTASENWEALVAFFNEFPQYKGNDFYVTGESYGGIYVPTLVQTIL 182          
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: SCP29_ARATH (Serine carboxypeptidase-like 29 OS=Arabidopsis thaliana GN=SCPL29 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 6.315e-36
Identity = 77/176 (43.75%), Postives = 110/176 (62.50%), Query Frame = 1
Query:  196 SAPETALIAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVESEGNPSKDPVVLWLNGGPGCSSFD-GFIYEHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTDYVT-GDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYVPTLAYEVMK 717
            S  E   ++++PG + N+   HYSG+V  +E  GR LFY+  E+  +    P+VLWLNGGPGCSS   G   E GPF+ +A         L++N YSW + ++I++LD+P GVG SYS   +D  + GD +TA D+  FLLKW E +PE+    F+I GESYAG Y+P L+  ++K
Sbjct:   31 SQKEQDKVSKLPGQNFNVSFAHYSGFVATNEQLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIKADG-----KTLYLNQYSWNQAANILFLDAPVGVGYSYSNTSSDLKSNGDKRTAEDSLKFLLKWVERFPEYKGRDFYIVGESYAGHYIPQLSEAIVK 201          
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: SCP28_ARATH (Serine carboxypeptidase-like 28 OS=Arabidopsis thaliana GN=SCPL28 PE=2 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 6.315e-36
Identity = 79/164 (48.17%), Postives = 103/164 (62.80%), Query Frame = 1
Query:  217 IAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVESEGNPSKDPVVLWLNGGPGCSSFD-GFIYEHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTDYVT-GDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYVPTLA 702
            I  +PG   NL    +SGYVTVD + GR LFY+  E+       P+VLWLNGGPGCSS   G   E GPF    P  K     L +N Y+W KV+++++LDSPAGVG SY+   +D +T GD +T  D + FL++W E +PE+    F+IAGESYAG Y+P LA
Sbjct:   38 IISLPGQPPNLNFSQFSGYVTVDPAAGRALFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVN-PDGK----TLRLNLYAWNKVANVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWLERFPEYKERAFYIAGESYAGHYIPELA 196          
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: SCP45_ARATH (Serine carboxypeptidase-like 45 OS=Arabidopsis thaliana GN=SCPL45 PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 5.346e-35
Identity = 88/191 (46.07%), Postives = 113/191 (59.16%), Query Frame = 1
Query:  139 IMYKILACYTL-LSFSVLTHSAPETALIAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVESEGNPSKDPVVLWLNGGPGCSSFD-GFIYEHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTDYV-TGDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYVPTLA 702
            I + ++  ++L +S SVL+HS   T L  Q       +  + YSGYVTVD+   R LFYYF E+E NPS  P+VLWLNGGPGCSS   G   E+GPF       KG  P L  N +SW + ++++YL++P GVG SYS   + Y    D  TA D   FL +WF  +P +L    FI GESYAG YVP LA
Sbjct:    9 ISFALIIFHSLTVSSSVLSHSDRVTRLPGQ-----PRVGFQQYSGYVTVDDKKQRALFYYFAEAETNPSSKPLVLWLNGGPGCSSLGVGAFSENGPFR-----PKG--PILVKNQHSWNQEANMLYLETPVGVGFSYSTQSSHYEGVNDKITARDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLA 187          
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: SCP36_ARATH (Serine carboxypeptidase-like 36 OS=Arabidopsis thaliana GN=SCPL36 PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 9.118e-35
Identity = 72/173 (41.62%), Postives = 101/173 (58.38%), Query Frame = 1
Query:  196 SAPETALIAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVESEGNPSKDPVVLWLNGGPGCSSFDGFIYEHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTDYVTGDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYVPTLAYEVM 714
            S  +  LI Q+PG   ++  K Y GYV V++  GR L+YYFVE+    +  P+V+W NGGPGCSS  G   E GPF   +         L  NPYSW   +++++L++P G G SYS +  +   GD  TA D + FL+ W E +PE+     +IAG+SYAG YVP LA  ++
Sbjct:   57 SPKDKDLIQQLPGQPSDVTFKQYGGYVAVNKPAGRFLYYYFVETIKPGNTTPLVIWFNGGPGCSSLGGAFKELGPFRVHSDGKT-----LFRNPYSWNNEANVLFLETPVGTGFSYSNSPINGKQGDKATAEDNYMFLVNWLERFPEYKGRDIYIAGQSYAGHYVPQLAQIIL 224          
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: CBP2_WHEAT (Serine carboxypeptidase 2 OS=Triticum aestivum GN=CBP2 PE=1 SV=2)

HSP 1 Score: 147.132 bits (370), Expect = 9.118e-35
Identity = 80/164 (48.78%), Postives = 105/164 (64.02%), Query Frame = 1
Query:  217 IAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVESEGNPSKDPVVLWLNGGPGCSSFD-GFIYEHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTD-YVTGDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYVPTLA 702
            IA++PG    +    YSGY+TVDE  GR+LFY   E+  +    P+VLWLNGGPGCSS   G   E G F  + P   G    L +N Y W KV+++++LDSPAGVG SY+   +D Y +GD +TA D++ FL KWFE +P +    F+IAGESYAG YVP L+
Sbjct:   11 IARLPGQPA-VDFDMYSGYITVDEGAGRSLFYLLQEAPEDAQPAPLVLWLNGGPGCSSVAYGASEELGAFRVK-PRGAG----LVLNEYRWNKVANVLFLDSPAGVGFSYTNTSSDIYTSGDNRTAHDSYAFLAKWFERFPHYKYRDFYIAGESYAGHYVPELS 168          
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: CBP23_HORVU (Serine carboxypeptidase II-3 OS=Hordeum vulgare GN=CXP;2-3 PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.191e-34
Identity = 77/175 (44.00%), Postives = 103/175 (58.86%), Query Frame = 1
Query:  205 ETALIAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVESEGN--PSKDPVVLWLNGGPGCSSFD-GFIYEHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTDYV-TGDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYVPTLAYEVMK 717
            E   +  +PG    +    Y+GYVTVD + GR LFYY  E+ G       P++LWLNGGPGCSS   G + E GPF   +         L+ NPYSW   +++++L+SPAGVG SYS    DY  +GD  TA D + FL  W E +PE+    F+I GESYAG YVP LA+ +++
Sbjct:   82 EADRVEALPGHPRGVDFAQYAGYVTVDAAAGRALFYYLAEAVGGNGDKTKPLLLWLNGGPGCSSLGYGAMEELGPFRVMSDGKT-----LYSNPYSWNHAANVLFLESPAGVGYSYSNTTADYGRSGDNGTAEDAYQFLDNWLERFPEYKGREFYITGESYAGHYVPQLAHAILR 251          
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: SCP40_ARATH (Serine carboxypeptidase-like 40 OS=Arabidopsis thaliana GN=SCPL40 PE=2 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 1.555e-34
Identity = 75/169 (44.38%), Postives = 104/169 (61.54%), Query Frame = 1
Query:  214 LIAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVESEGNPSKDPVVLWLNGGPGCSSFD-GFIYEHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTDYVT-GDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYVPTLAYEVM 714
            LI ++PG    +    Y GYVTV+ES GR+ FYYFVE+  +    P++LWLNGGPGCSS   G + E GPF   +         L  N Y+W   +++++L+SPAGVG SY+   +D    GD  TA+D + FL+ W E +PE+     +IAGESYAG YVP LA+ ++
Sbjct:   81 LIRRLPG-QPPVSFDQYGGYVTVNESAGRSFFYYFVEASKSKDSSPLLLWLNGGPGCSSLAYGALQELGPFRVHSDG-----KTLFRNRYAWNNAANVLFLESPAGVGFSYTNTTSDLEKHGDRNTAADNYIFLVNWLERFPEYKGRDLYIAGESYAGHYVPQLAHTIL 243          
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: SCP25_ARATH (Serine carboxypeptidase-like 25 OS=Arabidopsis thaliana GN=SCPL25 PE=2 SV=2)

HSP 1 Score: 145.591 bits (366), Expect = 2.653e-34
Identity = 81/205 (39.51%), Postives = 119/205 (58.05%), Query Frame = 1
Query:  136 LIMYKILACYTLLSFSVLTHSA----------PETALIAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVESEGNPSKDPVVLWLNGGPGCSSFD-GFIYEHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTD-YVTGDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYVPTLAYEVM 714
            + M K+    TL++  V+T              E   I  +PG   N+  + +SGYVTVD+  GR+LFY+  E+   P   P+V+WLNGGPGCSS   G   E GPF      +KG    L++N ++W  +S++++L++PAGVG SY+   +D + TGD +TA D+  FL++W   +P +     +I GESYAG YVP LA E+M
Sbjct:    1 MAMAKLAIFTTLMAILVMTSQGRIPTEGGEKEAEADRITSLPG-QPNVTFEQFSGYVTVDKLSGRSLFYWLTEASDLPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRI----SKGG-SGLYLNKFAWNSISNLLFLEAPAGVGFSYTNRSSDLFNTGDRRTAKDSLQFLIQWLHRFPRYNHREIYITGESYAGHYVPQLAKEIM 199          
BLAST of FC869089 vs. ExPASy Swiss-Prot
Match: CBP2_HORVU (Serine carboxypeptidase 2 OS=Hordeum vulgare GN=CBP2 PE=1 SV=2)

HSP 1 Score: 145.591 bits (366), Expect = 2.653e-34
Identity = 81/190 (42.63%), Postives = 109/190 (57.37%), Query Frame = 1
Query:  139 IMYKILACYTLLSFSVLTHSAPETALIAQIPGFSGNLPSKHYSGYVTVDESHGRNLFYYFVESEGNPSKDPVVLWLNGGPGCSSFD-GFIYEHGPFNFEAPTTKGSLPKLHVNPYSWTKVSSIIYLDSPAGVGLSYSENKTD-YVTGDLKTASDTHTFLLKWFELYPEFLANPFFIAGESYAGIYVPTLA 702
            ++   L C  L   +V          I ++PG    +    YSGY+TVDE+ GR+LFY   E+       P+VLWLNGGPGCSS   G   E G F    P   G    L +N Y W KV+++++LDSPAGVG SY+   +D Y +GD +TA D++ FL  WFE +P +    F++AGESYAG YVP L+
Sbjct:   17 VLLAALTCLLLRPAAVAAAGGHAADRIVRLPG-QPEVDFDMYSGYITVDEAAGRSLFYLLQEAPEEAQPAPLVLWLNGGPGCSSVAYGASEELGAFRV-MPRGAG----LVLNEYRWNKVANVLFLDSPAGVGFSYTNTSSDIYTSGDNRTAHDSYAFLAAWFERFPHYKYREFYVAGESYAGHYVPELS 200          
The following BLAST results are available for this feature:
BLAST of FC869089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 100
Match NameE-valueIdentityDescription
YUA6_CAEEL2.170e-3643.01Uncharacterized serine carboxypeptidase F13S12.6 O... [more]
SCP29_ARATH6.315e-3643.75Serine carboxypeptidase-like 29 OS=Arabidopsis tha... [more]
SCP28_ARATH6.315e-3648.17Serine carboxypeptidase-like 28 OS=Arabidopsis tha... [more]
SCP45_ARATH5.346e-3546.07Serine carboxypeptidase-like 45 OS=Arabidopsis tha... [more]
SCP36_ARATH9.118e-3541.62Serine carboxypeptidase-like 36 OS=Arabidopsis tha... [more]
CBP2_WHEAT9.118e-3548.78Serine carboxypeptidase 2 OS=Triticum aestivum GN=... [more]
CBP23_HORVU1.191e-3444.00Serine carboxypeptidase II-3 OS=Hordeum vulgare GN... [more]
SCP40_ARATH1.555e-3444.38Serine carboxypeptidase-like 40 OS=Arabidopsis tha... [more]
SCP25_ARATH2.653e-3439.51Serine carboxypeptidase-like 25 OS=Arabidopsis tha... [more]
CBP2_HORVU2.653e-3442.63Serine carboxypeptidase 2 OS=Hordeum vulgare GN=CB... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31008D08EF AbioticL1 Citrus clementina cDNA clone C31008D08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869089 ID=FC869089; Name=FC869089; organism=Citrus clementina; type=EST; length=735bp
AGAAAAATATTGGACTGTAATCCACGTTTTTTCAATAGAAACTTGCATTT
TCACCAACTATATAAATGCGTCTCGGGGATCCTCAAACAGTCATGCAGTC
TACTCTAATCAAACTTTTTAATGGGTAAAGGTCGTCTTATCATGTACAAG
ATACTAGCTTGTTACACATTATTGAGCTTTTCAGTGTTGACTCATTCAGC
TCCTGAAACTGCTCTCATCGCTCAGATTCCTGGCTTCTCTGGCAATCTCC
CTTCCAAGCACTATTCTGGGTATGTGACGGTTGATGAAAGCCATGGGAGG
AACCTCTTTTACTACTTTGTTGAATCCGAAGGGAATCCATCCAAGGATCC
TGTGGTTCTGTGGCTCAATGGTGGACCAGGATGCTCCAGCTTTGATGGTT
TTATATATGAGCACGGGCCTTTCAATTTTGAAGCACCAACGACAAAGGGA
AGTCTGCCCAAGTTGCATGTCAATCCATATAGCTGGACCAAGGTTTCTAG
CATTATATATTTAGATTCCCCAGCTGGTGTTGGACTTTCTTACTCAGAAA
ATAAAACTGATTATGTTACTGGGGACTTAAAGACTGCCTCTGATACACAC
ACATTTCTCCTCAAGTGGTTTGAACTATACCCGGAGTTCCTAGCCAACCC
ATTTTTTATTGCTGGAGAGTCATATGCTGGGATATATGTGCCCACTCTTG
CTTATGAAGTGATGAAAGGAATTGATGCTGGTGAA
back to top