FC869212

Overview
NameFC869212
Unique NameFC869212
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length401
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10231 contig Ccv1_Contig10231:291..691. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_AZOC5 (Chaperone protein dnaK OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / ORS 571) GN=dnaK PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 2.120e-50
Identity = 92/133 (69.17%), Postives = 112/133 (84.21%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            G +PKVIEN+EG+RTTPS+VAF + GE LVG PAKRQ  TNP  T F  KRLIGR++DDP  +++ ++V YK+VRA NGDAWVE++G++YSPSQI AF+L KMKETAES+LG+ V KAVITVPAYFNDAQRQA
Sbjct:   21 GASPKVIENAEGARTTPSIVAFTEDGERLVGQPAKRQGVTNPERTFFAVKRLIGRRYDDPTVEKDKKLVPYKVVRADNGDAWVESDGKKYSPSQISAFILQKMKETAESFLGEKVEKAVITVPAYFNDAQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_RHOP2 (Chaperone protein dnaK OS=Rhodopseudomonas palustris (strain HaA2) GN=dnaK PE=2 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 3.616e-50
Identity = 92/133 (69.17%), Postives = 111/133 (83.46%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            GKN KVIEN+EG RTTPS+VAF+  GE LVG PAKRQA TNP  T F  KRL+GR++DDP  +++ ++V YKIV+A NGDAWVEA+GQ YSPSQ+ AF+L KMKETAE++LG+ V +AVITVPAYFNDAQRQA
Sbjct:   21 GKNSKVIENAEGMRTTPSIVAFSDDGERLVGQPAKRQAVTNPERTFFAVKRLVGRRYDDPMVEKDKKLVPYKIVKASNGDAWVEADGQTYSPSQVSAFILQKMKETAEAHLGQKVDQAVITVPAYFNDAQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_BARBK (Chaperone protein dnaK OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dnaK PE=2 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 3.616e-50
Identity = 95/133 (71.43%), Postives = 108/133 (81.20%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            GKN KVIENSEG+RTTPSVVAF   GE LVG PAKRQA TNP  T+F  KRLIGR+FDDP  +++  +V YKIV+  NGDAWVE N ++YSPSQI A +L KMKETAESYLG+ V +AVITVPAYFNDAQRQA
Sbjct:   21 GKNAKVIENSEGARTTPSVVAFTDSGERLVGQPAKRQAVTNPEGTVFAVKRLIGRRFDDPMVEKDKALVPYKIVKGDNGDAWVEENSKKYSPSQISAMILQKMKETAESYLGEKVEQAVITVPAYFNDAQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_ZYMMO (Chaperone protein dnaK OS=Zymomonas mobilis GN=dnaK PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 4.723e-50
Identity = 94/133 (70.68%), Postives = 110/133 (82.71%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            G  PKVIEN+EG+RTTPS+VAF +  E L+G PAKRQA TN  NT+F  KRLIGR+FDDP T+R+ ++V Y IVR  NGDAWV+A GQ YSPSQI AF+L KMKETAESYLG++V +AVITVPAYFNDAQRQA
Sbjct:   21 GGQPKVIENAEGARTTPSIVAFTKDSERLIGQPAKRQAVTNSENTIFAVKRLIGRRFDDPVTKRDTELVPYHIVRGSNGDAWVKAGGQDYSPSQISAFILQKMKETAESYLGETVDQAVITVPAYFNDAQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_ACICJ (Chaperone protein dnaK OS=Acidiphilium cryptum (strain JF-5) GN=dnaK PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 4.723e-50
Identity = 93/133 (69.92%), Postives = 115/133 (86.47%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            GK+ +VIENSEG+RTTPS+VAF++  E LVG  AKRQA TNPTNTL+  KRLIGR++DDP  +++  +VSY IVR  NGDAWVE+ GQ+Y+PSQI +FVLTKMKETAE+YLG++V++AVITVPAYFNDAQRQA
Sbjct:   21 GKDVRVIENSEGARTTPSMVAFSESNERLVGQSAKRQAVTNPTNTLYAVKRLIGRRYDDPTVEKDKGLVSYNIVRGDNGDAWVESRGQRYAPSQISSFVLTKMKETAEAYLGEAVTQAVITVPAYFNDAQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_RHILO (Chaperone protein dnaK OS=Rhizobium loti GN=dnaK PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 8.056e-50
Identity = 93/133 (69.92%), Postives = 111/133 (83.46%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            GK PKVIEN+EG+RTTPS+VA +  GE LVG PAKRQA TNP NT+F  KRLIGR++DDP T+++ ++V YKIV+  NGDAWVEA G++ SPSQI A +L KMKETAE+YLG+ V KAVITVPAYFNDAQRQA
Sbjct:   21 GKEPKVIENAEGARTTPSIVAISGDGERLVGQPAKRQAVTNPENTIFAVKRLIGRRYDDPVTEKDKKLVPYKIVKGDNGDAWVEAGGKKQSPSQISAMILQKMKETAEAYLGEKVEKAVITVPAYFNDAQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_RHIEC (Chaperone protein dnaK OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaK PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 8.056e-50
Identity = 93/133 (69.92%), Postives = 111/133 (83.46%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            GK+ KVIEN+EG+RTTPS+VAF+  GE LVG PAKRQA TNPTNTLF  KRLIGR+++DP  +++  +V + IV+  NGDAWVEANG+ YSP+QI A +L KMKETAESYLG+ V KAVITVPAYFNDAQRQA
Sbjct:   21 GKDAKVIENAEGARTTPSMVAFSDDGERLVGQPAKRQAVTNPTNTLFAVKRLIGRRYEDPTVEKDKHLVPFSIVKGDNGDAWVEANGKGYSPAQISAMILQKMKETAESYLGEKVEKAVITVPAYFNDAQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_RHIE6 (Chaperone protein dnaK OS=Rhizobium etli (strain CIAT 652) GN=dnaK PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 8.056e-50
Identity = 93/133 (69.92%), Postives = 111/133 (83.46%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            GK+ KVIEN+EG+RTTPS+VAF+  GE LVG PAKRQA TNPTNTLF  KRLIGR+++DP  +++  +V + IV+  NGDAWVEANG+ YSP+QI A +L KMKETAESYLG+ V KAVITVPAYFNDAQRQA
Sbjct:   21 GKDAKVIENAEGARTTPSMVAFSDDGERLVGQPAKRQAVTNPTNTLFAVKRLIGRRYEDPTVEKDKHLVPFSIVKGDNGDAWVEANGKGYSPAQISAMILQKMKETAESYLGEKVEKAVITVPAYFNDAQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_NITWN (Chaperone protein dnaK OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=dnaK PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 8.056e-50
Identity = 93/133 (69.92%), Postives = 110/133 (82.71%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            GK PKVIEN+EG RTTPS+VAF+  GE LVG PAKRQA TNP  T+F  KRLIGR++DDP  +++ Q+V YKI +A NGDAWVEA+G+ YSPSQI AF L KMKETAE++LG+ V +AVITVPAYFNDAQRQA
Sbjct:   21 GKTPKVIENAEGMRTTPSIVAFSDDGERLVGQPAKRQAVTNPERTIFAVKRLIGRRYDDPTVEKDKQLVPYKIAKAGNGDAWVEADGKTYSPSQISAFTLQKMKETAEAHLGQKVDQAVITVPAYFNDAQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_GLUOX (Chaperone protein dnaK OS=Gluconobacter oxydans GN=dnaK PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 8.056e-50
Identity = 95/133 (71.43%), Postives = 110/133 (82.71%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            G   KVIENSEG+RTTPS+VAF   GE LVG  AKRQA TNP NTL+  KRLIGR++DDP  Q++ +MV Y IVR  NGDAWVEA G++Y+PSQI A+VL KMKETAESYLG++VS+AVITVPAYFNDAQRQA
Sbjct:   21 GDETKVIENSEGARTTPSMVAFTDNGERLVGQAAKRQAVTNPANTLYAVKRLIGRRYDDPTVQKDKEMVPYAIVRGDNGDAWVEARGEKYAPSQIAAYVLGKMKETAESYLGETVSQAVITVPAYFNDAQRQA 153          
The following BLAST results are available for this feature:
BLAST of FC869212 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAK_AZOC52.120e-5069.17Chaperone protein dnaK OS=Azorhizobium caulinodans... [more]
DNAK_RHOP23.616e-5069.17Chaperone protein dnaK OS=Rhodopseudomonas palustr... [more]
DNAK_BARBK3.616e-5071.43Chaperone protein dnaK OS=Bartonella bacilliformis... [more]
DNAK_ZYMMO4.723e-5070.68Chaperone protein dnaK OS=Zymomonas mobilis GN=dna... [more]
DNAK_ACICJ4.723e-5069.92Chaperone protein dnaK OS=Acidiphilium cryptum (st... [more]
DNAK_RHILO8.056e-5069.92Chaperone protein dnaK OS=Rhizobium loti GN=dnaK P... [more]
DNAK_RHIEC8.056e-5069.92Chaperone protein dnaK OS=Rhizobium etli (strain C... [more]
DNAK_RHIE68.056e-5069.92Chaperone protein dnaK OS=Rhizobium etli (strain C... [more]
DNAK_NITWN8.056e-5069.92Chaperone protein dnaK OS=Nitrobacter winogradskyi... [more]
DNAK_GLUOX8.056e-5071.43Chaperone protein dnaK OS=Gluconobacter oxydans GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31009G02EF AbioticL1 Citrus clementina cDNA clone C31009G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869212 ID=FC869212; Name=FC869212; organism=Citrus clementina; type=EST; length=401bp
GGGAAAGAACCCCAAAGTTATTGAGAACTCCGAAGGATCTAGGACTACAC
CATCAGTTGTAGCTTTCAATCAGAAGGGAGAGCTACTTGTGGGTACACCA
GCAAAGCGTCAGGCTGCGACCAACCCGACTAACACGCTCTTTGGCACCAA
GCGTTTAATTGGTAGAAAATTTGATGATCCCCAGACGCAAAGAGAAATGC
AGATGGTTTCATATAAGATAGTAAGGGCCCCCAATGGGGATGCTTGGGTT
GAAGCCAATGGGCAGCAGTACTCGCCAAGTCAGATTGGGGCCTTTGTTCT
GACCAAGATGAAAGAAACTGCAGAATCCTACCTTGGAAAGTCAGTTTCAA
AAGCAGTAATCACAGTTCCAGCTTATTTCAACGATGCTCAAAGGCAAGCT
A
back to top