FC873168
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC873168 vs. ExPASy Swiss-Prot
Match: CB4A_ARATH (Chlorophyll a-b binding protein CP29.1, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.1 PE=1 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 1.318e-12 Identity = 35/58 (60.34%), Postives = 43/58 (74.14%), Query Frame = 2 Query: 2 FDPLVLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVN 175 FDPL LA DPE A+L++ EIK+ RLAM + GF VQA TGKGPL N A HL+DP++ Sbjct: 223 FDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLH 280
BLAST of FC873168 vs. ExPASy Swiss-Prot
Match: CB4B_ARATH (Chlorophyll a-b binding protein CP29.2, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.2 PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 8.545e-12 Identity = 34/58 (58.62%), Postives = 41/58 (70.69%), Query Frame = 2 Query: 2 FDPLVLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVN 175 FDPL LA DP A+L++ EIK+ RLAM GF VQA TGKGPL N A HL+DP++ Sbjct: 220 FDPLGLASDPVKKAQLQLAEIKHARLAMVGFLGFAVQAAATGKGPLNNWATHLSDPLH 277 The following BLAST results are available for this feature:
BLAST of FC873168 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 72
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC873168 ID=FC873168; Name=FC873168; organism=Citrus clementina; type=EST; length=459bpback to top |