FC875481

Overview
NameFC875481
Unique NameFC875481
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length703
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:223..925. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP72_YEAST (Heat shock protein SSA2 OS=Saccharomyces cerevisiae GN=SSA2 PE=1 SV=3)

HSP 1 Score: 353.599 bits (906), Expect = 5.950e-97
Identity = 182/234 (77.78%), Postives = 202/234 (86.32%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS+VGFTDTERLIGDAAKNQ AMNP NTVFDAKRLIGR F+D  VQGDMK +PFK+I     KP I V +KGE K F  E+ISSMVL KM+E AE+YLG+ + +AVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKK     E++VLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNR+VNHF+QEFKRK + D+S N RALRRLRTA
Sbjct:   34 RTTPSFVGFTDTERLIGDAAKNQAAMNPANTVFDAKRLIGRNFNDPEVQGDMKHFPFKLIDVDG-KPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKGK---EEHVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRALRRLRTA 263          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_BLAEM (Heat shock 70 kDa protein OS=Blastocladiella emersonii GN=HSP70 PE=3 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 5.950e-97
Identity = 184/234 (78.63%), Postives = 198/234 (84.62%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYVGFTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGRRF D  VQ DMK W F V+     KP+  V +KGE K F  EE SSM+L KM+E AEAYLG+ + +AVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKKA   GEKNVLIFDLGGGTFDVSLLTIE+GIFEVKATAGDTHLG EDFDNR+VNHFVQEFKRK + D+SG  R  RRLRTA
Sbjct:   39 RTTPSYVGFTDSERLIGDAAKNQVAMNPHNTVFDAKRLIGRRFDDDVVQADMKHWSFTVV-NKNSKPLFQVEFKGETKTFTPEEFSSMILTKMKETAEAYLGTKVNHAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKA-EAGEKNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGAEDFDNRLVNHFVQEFKRKHKKDLSGKARP-RRLRTA 269          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_AJECA (Heat shock 70 kDa protein OS=Ajellomyces capsulata GN=HSP70 PE=3 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 7.771e-97
Identity = 186/235 (79.15%), Postives = 201/235 (85.53%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRK-KQXDISGNPRALRRLRTA 702
            RTTPS+V FTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+D  VQ DMK +PFK I     KP+I V +KGE K+F  EEISSMVL KMRE AEAYLG T+ NAVVTVPAYFNDSQRQATKDAG+IAGLNV+RIINEPTAAAIAYGLDKKA   GE+NVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLGGEDFDNR+VNHFV EFKRK K+   +   RALRR  TA
Sbjct:   34 RTTPSFVAFTDTERLIGDAAKNQVAMNPANTVFDAKRLIGRKFADPEVQADMKHFPFK-ITDKGGKPVIQVEFKGETKEFTPEEISSMVLTKMRETAEAYLGGTVNNAVVTVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIAYGLDKKAD--GERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFVSEFKRKFKKISPAERARALRRSPTA 265          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7B_DROME (Heat shock 70 kDa protein cognate 2 OS=Drosophila melanogaster GN=Hsc70-2 PE=1 SV=2)

HSP 1 Score: 352.829 bits (904), Expect = 1.015e-96
Identity = 182/235 (77.45%), Postives = 200/235 (85.11%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEG-IFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV F +TERLIGD AKNQVAMN  NTVFDAKRLIGR+F D  +Q D+KLWPFKVI     KP I V +KGE K+FA EEISSMVL KMREIAE YLG  +K+AVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAA+AYGLDK     GE+NVLIFDLGGGTFDVS+L+I+EG +FEVKATAGDTHLGGEDFDNR+VNHF +EFKRK + DI GN RALRRLRTA
Sbjct:   36 RTTPSYVAFNETERLIGDPAKNQVAMNAKNTVFDAKRLIGRKFDDKKIQEDLKLWPFKVI-NEKGKPKIEVEFKGERKRFAPEEISSMVLTKMREIAEVYLGGKVKDAVVTVPAYFNDSQRQATKDAGSIAGLNVLRIINEPTAAALAYGLDKNLK--GERNVLIFDLGGGTFDVSVLSIDEGSLFEVKATAGDTHLGGEDFDNRLVNHFAEEFKRKHKSDIKGNARALRRLRTA 267          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP74_TRYBB (Heat shock 70 kDa protein 4 OS=Trypanosoma brucei brucei PE=2 SV=2)

HSP 1 Score: 352.443 bits (903), Expect = 1.325e-96
Identity = 182/235 (77.45%), Postives = 201/235 (85.53%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRK-KQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGDAAKNQVAMNPTNTVFDAKRLIGR+FSD+ VQ DMK WPFKV+    DKP+I V ++GE K F  EEISSMVL+KM+E+AE+YLG  +  AVVTVPAYFNDSQRQATKDAG IAGL V+RIINEPTAAAIAYGLD KA    E+NVLIFDLGGGTFDV+LLTI+ GIFEVKAT GDTHLGGEDFDNR+V HF +EFKRK K  D+S N RALRRLRTA
Sbjct:   36 RTTPSYVAFTDSERLIGDAAKNQVAMNPTNTVFDAKRLIGRKFSDSVVQSDMKHWPFKVVTKGDDKPVIQVQFRGETKTFNPEEISSMVLLKMKEVAESYLGKQVAKAVVTVPAYFNDSQRQATKDAGTIAGLEVLRIINEPTAAAIAYGLD-KADEGKERNVLIFDLGGGTFDVTLLTIDGGIFEVKATNGDTHLGGEDFDNRLVAHFTEEFKRKNKGKDLSSNLRALRRLRTA 269          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP76_PIG (Heat shock 70 kDa protein 6 OS=Sus scrofa GN=HSPA6 PE=2 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 1.731e-96
Identity = 173/234 (73.93%), Postives = 205/234 (87.61%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERL+GDAAK+Q A+NP NTVFDAKRLIGR+F+D +VQ D+K WPF+V++    KP + V+Y+GE+K F  EEISSMVL KM+E AEAYLG  +++AV+TVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLD++    GE+NVLIFDLGGGTFDVS+LTI+ G+FEVKATAGDTHLGGEDFDNR+VNHF++EF+RK + D+S N RALRRLRTA
Sbjct:   38 RTTPSYVAFTDTERLVGDAAKSQAALNPQNTVFDAKRLIGRKFADPTVQSDLKHWPFQVVS-EGGKPKVRVSYRGEDKAFYPEEISSMVLSKMKETAEAYLGQPVRHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRR--GAGERNVLIFDLGGGTFDVSVLTIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRKHRKDLSRNKRALRRLRTA 268          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP71_PICAN (Heat shock protein 70 1 OS=Pichia angusta GN=HSA1 PE=1 SV=2)

HSP 1 Score: 352.058 bits (902), Expect = 1.731e-96
Identity = 177/234 (75.64%), Postives = 199/234 (85.04%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS+V FTDTERLIGDAAKNQ AMNP NTVFDAKRLIGR+F D  VQ D+K +PFKV+     KP I V +KGE K F  EEISSMVL KM+E AE+Y+G  + +AV+TVPAYFNDSQRQATKDAG+IAGLNV+RIINEPTAAAIAYGLDKK    GE+N+LIFDLGGGTFDVSLL+I+EGIFEVKATAGDTHLGGEDFDNR+VNHF  EFKRK + D++ N RALRRLRTA
Sbjct:   34 RTTPSFVAFTDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDDPEVQNDIKHFPFKVVE-KGGKPHIQVEFKGETKVFTPEEISSMVLTKMKETAESYMGGKVTDAVITVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIAYGLDKKEQGKGEQNILIFDLGGGTFDVSLLSIDEGIFEVKATAGDTHLGGEDFDNRLVNHFANEFKRKYKKDLTTNQRALRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_BRELC (Heat shock 70 kDa protein OS=Bremia lactucae GN=HSP70 PE=3 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 1.731e-96
Identity = 181/234 (77.35%), Postives = 201/234 (85.90%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMN  NTVFDAK LIGR+FSD  VQ D+K WPFK+ +G     ++ V +KGE K F  EEISSMVLIKMRE+AEA++G  +KNAV+TVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKK    GE+NVLIFDLGGGTFDVSLL+IEEGIFEVK+TA DTHLGGEDFDNR+V+HF QEFKRK + DI+ N RALRRLRTA
Sbjct:   39 RTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVFDAKPLIGRKFSDPIVQADIKHWPFKLTSGWRQAQIV-VQFKGESKTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKG---GERNVLIFDLGGGTFDVSLLSIEEGIFEVKSTARDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTA 268          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP68_DROME (Heat shock protein 68 OS=Drosophila melanogaster GN=Hsp68 PE=1 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 1.731e-96
Identity = 178/235 (75.74%), Postives = 203/235 (86.38%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEG-IFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGDAAKNQVAMNP N+VFDAKRLIGRRF D+ +Q D+K WPFKVI     KP I V +KG  K F+ EEISSMVL KM+E AEAYLG+T+K+AV+TVPAYFNDSQRQATKDAG IAG+NV+RIINEPTAAA+AYGLDK     GE+NVLIFDLGGGTFDVS+LTI+EG +FEV++TAGDTHLGGEDFDNR+VNHF +EFKRK + D+  NPRALRRLRTA
Sbjct:   33 RTTPSYVAFTDSERLIGDAAKNQVAMNPKNSVFDAKRLIGRRFDDSKIQEDIKHWPFKVI-NDNGKPKISVEFKGANKCFSPEEISSMVLTKMKETAEAYLGTTVKDAVITVPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAYGLDKNLK--GERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVNHFAEEFKRKYKKDLRSNPRALRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7C_DANRE (Heat shock cognate 71 kDa protein OS=Danio rerio GN=hspa8 PE=2 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 3.857e-96
Identity = 180/234 (76.92%), Postives = 197/234 (84.19%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNTV DA RL GR+F D  VQ DMK WPF VI     +P + V YKGE K F  EEISSMVL KM+EIAEAYLG T+ NAV+TVPAY NDSQRQATKDAG I+GLNV+ IINEPTAAAIAYGLDKK  +  E+NVLIFDLGGG+FDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHF+ EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVLDANRLNGRQFDDGVVQSDMKHWPFNVI-NDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYSNDSQRQATKDAGTISGLNVLVIINEPTAAAIAYGLDKKVGA--ERNVLIFDLGGGSFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTA 266          
The following BLAST results are available for this feature:
BLAST of FC875481 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP72_YEAST5.950e-9777.78Heat shock protein SSA2 OS=Saccharomyces cerevisia... [more]
HSP70_BLAEM5.950e-9778.63Heat shock 70 kDa protein OS=Blastocladiella emers... [more]
HSP70_AJECA7.771e-9779.15Heat shock 70 kDa protein OS=Ajellomyces capsulata... [more]
HSP7B_DROME1.015e-9677.45Heat shock 70 kDa protein cognate 2 OS=Drosophila ... [more]
HSP74_TRYBB1.325e-9677.45Heat shock 70 kDa protein 4 OS=Trypanosoma brucei ... [more]
HSP76_PIG1.731e-9673.93Heat shock 70 kDa protein 6 OS=Sus scrofa GN=HSPA6... [more]
HSP71_PICAN1.731e-9675.64Heat shock protein 70 1 OS=Pichia angusta GN=HSA1 ... [more]
HSP70_BRELC1.731e-9677.35Heat shock 70 kDa protein OS=Bremia lactucae GN=HS... [more]
HSP68_DROME1.731e-9675.74Heat shock protein 68 OS=Drosophila melanogaster G... [more]
HSP7C_DANRE3.857e-9676.92Heat shock cognate 71 kDa protein OS=Danio rerio G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404D09EF CTVClemen1 Citrus clementina cDNA clone C31404D09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875481 ID=FC875481|Name=FC875481|organism=Citrus clementina|type=EST|length=703bp
AGGACGACGCCGTCTTATGTGGGGTTCACCGACACGGAGCGTTTGATCGG
GGACGCTGCTAAGAACCAGGTCGCCATGAACCCCACGAACACCGTCTTTG
ATGCAAAGAGGTTGATTGGTAGGAGATTCAGCGATGCATCAGTCCAAGGA
GATATGAAGCTATGGCCATTTAAGGTGATTGCTGGACCAGCTGACAAGCC
CATGATTGGTGTTAACTACAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGG
AAATCTCGTCTATGGTGCTCATCAAGATGCGTGAGATTGCCGAGGCTTAC
CTTGGCTCAACTATTAAGAATGCAGTCGTTACTGTCCCTGCTTACTTCAA
TGACTCACAGAGGCAGGCCACCAAGGATGCTGGTGTCATTGCTGGGCTTA
ATGTGATGCGTATCATCAATGAGCCCACTGCTGCTGCCATTGCTTATGGC
CTTGACAAGAAGGCTACTAGTGTGGGTGAGAAGAATGTGTTGATCTTTGA
TTTGGGTGGTGGTACTTTTGATGTGTCGTTGCTCACTATTGAGGAGGGAA
TCTTTGAAGTGAAGGCTACTGCTGGAGACACTCATCTTGGTGGTGAGGAT
TTTGATAACAGAATGGTGAATCATTTTGTTCAGGAGTTTAAGAGGAAGAA
ACAGAANGATATTAGTGGCAACCCTAGAGCTCTTAGGAGATTGAGGACTG
CTT
back to top