FC875481

Overview
NameFC875481
Unique NameFC875481
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length703
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:223..925. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_ECHGR (Heat shock cognate 70 kDa protein OS=Echinococcus granulosus GN=HSP70 PE=2 SV=1)

HSP 1 Score: 349.747 bits (896), Expect = 8.591e-96
Identity = 180/235 (76.60%), Postives = 203/235 (86.38%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRK-KQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRF D +VQ D+K W FKVI     KP I V Y+GE K F+AEEISSMVL+KM+E AEAYLG  + + V++VPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYGLDKK     E+NVLIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFD+R+VNHFV+EFKRK K  D++ N RA+RRLRTA
Sbjct:   37 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDRAVQDDIKHWAFKVI-NAGGKPKIEVEYRGETKCFSAEEISSMVLLKMKETAEAYLGKKVSDTVISVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVER--ERNVLIFDLGGGTFDVSILSIEDGIFEVKSTAGDTHLGGEDFDSRLVNHFVEEFKRKHKGKDLTTNKRAVRRLRTA 268          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP71_YEAST (Heat shock protein SSA1 OS=Saccharomyces cerevisiae GN=SSA1 PE=1 SV=4)

HSP 1 Score: 349.362 bits (895), Expect = 1.122e-95
Identity = 180/234 (76.92%), Postives = 201/234 (85.90%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS+V FTDTERLIGDAAKNQ AMNP+NTVFDAKRLIGR F+D  VQ DMK +PFK+I     KP I V +KGE K F  E+ISSMVL KM+E AE+YLG+ + +AVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKK     E++VLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNR+VNHF+QEFKRK + D+S N RALRRLRTA
Sbjct:   34 RTTPSFVAFTDTERLIGDAAKNQAAMNPSNTVFDAKRLIGRNFNDPEVQADMKHFPFKLIDVDG-KPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKGK---EEHVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRALRRLRTA 263          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP75_DROME (Major heat shock 70 kDa protein Bc OS=Drosophila melanogaster GN=Hsp70Bc PE=2 SV=2)

HSP 1 Score: 348.591 bits (893), Expect = 1.914e-95
Identity = 177/235 (75.32%), Postives = 200/235 (85.11%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEG-IFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGD AKNQVAMNP NTVFDAKRLIGR++ D  +  DMK WPFKV++    KP IGV YKGE K+FA EEISSMVL KM+E AEAYLG +I +AV+TVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAA+AYGLDK     GE+NVLIFDLGGGTFDVS+LTI+EG +FEV++TAGDTHLGGEDFDNR+V H  +EFKRK + D+  NPRALRRLRTA
Sbjct:   33 RTTPSYVAFTDSERLIGDPAKNQVAMNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSD-GGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLK--GERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVTHLAEEFKRKYKKDLRSNPRALRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP73_DROME (Major heat shock 70 kDa protein Bb OS=Drosophila melanogaster GN=Hsp70Bb PE=2 SV=2)

HSP 1 Score: 348.591 bits (893), Expect = 1.914e-95
Identity = 177/235 (75.32%), Postives = 200/235 (85.11%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEG-IFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGD AKNQVAMNP NTVFDAKRLIGR++ D  +  DMK WPFKV++    KP IGV YKGE K+FA EEISSMVL KM+E AEAYLG +I +AV+TVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAA+AYGLDK     GE+NVLIFDLGGGTFDVS+LTI+EG +FEV++TAGDTHLGGEDFDNR+V H  +EFKRK + D+  NPRALRRLRTA
Sbjct:   33 RTTPSYVAFTDSERLIGDPAKNQVAMNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSD-GGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLK--GERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVTHLAEEFKRKYKKDLRSNPRALRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP72_DROSI (Major heat shock 70 kDa protein Ba OS=Drosophila simulans GN=Hsp70Ba PE=2 SV=2)

HSP 1 Score: 348.591 bits (893), Expect = 1.914e-95
Identity = 177/235 (75.32%), Postives = 200/235 (85.11%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEG-IFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGD AKNQVAMNP NTVFDAKRLIGR++ D  +  DMK WPFKV++    KP IGV YKGE K+FA EEISSMVL KM+E AEAYLG +I +AV+TVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAA+AYGLDK     GE+NVLIFDLGGGTFDVS+LTI+EG +FEV++TAGDTHLGGEDFDNR+V H  +EFKRK + D+  NPRALRRLRTA
Sbjct:   33 RTTPSYVAFTDSERLIGDPAKNQVAMNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSD-CGKPKIGVEYKGESKRFAPEEISSMVLAKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLK--GERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVTHLAEEFKRKYKKDLRSNPRALRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP72_DROME (Major heat shock 70 kDa protein Ba OS=Drosophila melanogaster GN=Hsp70Ba PE=2 SV=2)

HSP 1 Score: 348.591 bits (893), Expect = 1.914e-95
Identity = 177/235 (75.32%), Postives = 200/235 (85.11%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEG-IFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGD AKNQVAMNP NTVFDAKRLIGR++ D  +  DMK WPFKV++    KP IGV YKGE K+FA EEISSMVL KM+E AEAYLG +I +AV+TVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAA+AYGLDK     GE+NVLIFDLGGGTFDVS+LTI+EG +FEV++TAGDTHLGGEDFDNR+V H  +EFKRK + D+  NPRALRRLRTA
Sbjct:   33 RTTPSYVAFTDSERLIGDPAKNQVAMNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSD-GGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLK--GERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVTHLAEEFKRKYKKDLRSNPRALRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP71_DROSI (Major heat shock 70 kDa protein Ab OS=Drosophila simulans GN=Hsp70Ab PE=2 SV=2)

HSP 1 Score: 348.591 bits (893), Expect = 1.914e-95
Identity = 176/235 (74.89%), Postives = 201/235 (85.53%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEG-IFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGD AKNQVAMNP NTVFDAKRLIGR++ D  +  D+K WPFKV++    KP IGV YKGE K+FA EEISSMVL+KM+E AEAYLG +I +AV+TVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAA+AYGLDK     GE+NVLIFDLGGGTFDVS+LTI+EG +FEV++TAGDTHLGGEDFDNR+V H  +EFKRK + D+  NPRALRRLRTA
Sbjct:   33 RTTPSYVAFTDSERLIGDPAKNQVAMNPRNTVFDAKRLIGRKYDDPKIAEDIKHWPFKVVSD-GGKPKIGVEYKGESKRFAPEEISSMVLVKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLK--GERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVTHLAEEFKRKYKKDLRSNPRALRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_THEPA (Heat shock 70 kDa protein OS=Theileria parva GN=TP02_0148 PE=2 SV=2)

HSP 1 Score: 348.591 bits (893), Expect = 1.914e-95
Identity = 180/234 (76.92%), Postives = 198/234 (84.62%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKR-KKQXDISGNPRALRRLRT 699
            RTTPSYV FTDTERLIGDAAKNQ A NP NT+FDAKRLIGR+F D +VQ DMK WPFKV  GP  KP I V ++GE+K F AEEISSMVL KM+EIAEA+LG ++K+ V+TVPAYFNDSQRQATKDAG IAGLNVMRIINEPTAAAIAYGLDKK    GEKNVLIFDLGGGTFDVS+LTIE+GIFEVKATAGDTHLGGEDFDN +V H V++F R     +IS N RALRRLRT
Sbjct:   35 RTTPSYVAFTDTERLIGDAAKNQEARNPENTIFDAKRLIGRKFDDRTVQEDMKHWPFKVTNGPNGKPNIEVTFQGEKKTFHAEEISSMVLTKMKEIAEAFLGKSVKDVVITVPAYFNDSQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKGG--GEKNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNLLVEHCVRDFMRLNNGKNISSNKRALRRLRT 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP71_DROME (Major heat shock 70 kDa protein Ab OS=Drosophila melanogaster GN=Hsp70Ab PE=1 SV=3)

HSP 1 Score: 347.821 bits (891), Expect = 3.265e-95
Identity = 177/235 (75.32%), Postives = 199/235 (84.68%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEG-IFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGD AKNQVAMNP NTVFDAKRLIGR++ D  +  DMK WPFKV++    KP IGV YKGE K+FA EEISSMVL KM+E AEAYLG +I +AV+TVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAA+AYGLDK     GE+NVLIFDLGGGTFDVS+LTI+EG +FEV++TAGDTHLGGEDFDNR+V H   EFKRK + D+  NPRALRRLRTA
Sbjct:   33 RTTPSYVAFTDSERLIGDPAKNQVAMNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSD-GGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLK--GERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVTHLADEFKRKYKKDLRSNPRALRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_DROME (Major heat shock 70 kDa protein Aa OS=Drosophila melanogaster GN=Hsp70Aa PE=2 SV=2)

HSP 1 Score: 347.821 bits (891), Expect = 3.265e-95
Identity = 177/235 (75.32%), Postives = 199/235 (84.68%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEG-IFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGD AKNQVAMNP NTVFDAKRLIGR++ D  +  DMK WPFKV++    KP IGV YKGE K+FA EEISSMVL KM+E AEAYLG +I +AV+TVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAA+AYGLDK     GE+NVLIFDLGGGTFDVS+LTI+EG +FEV++TAGDTHLGGEDFDNR+V H   EFKRK + D+  NPRALRRLRTA
Sbjct:   33 RTTPSYVAFTDSERLIGDPAKNQVAMNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSD-GGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLK--GERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVTHLADEFKRKYKKDLRSNPRALRRLRTA 264          
The following BLAST results are available for this feature:
BLAST of FC875481 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP70_ECHGR8.591e-9676.60Heat shock cognate 70 kDa protein OS=Echinococcus ... [more]
HSP71_YEAST1.122e-9576.92Heat shock protein SSA1 OS=Saccharomyces cerevisia... [more]
HSP75_DROME1.914e-9575.32Major heat shock 70 kDa protein Bc OS=Drosophila m... [more]
HSP73_DROME1.914e-9575.32Major heat shock 70 kDa protein Bb OS=Drosophila m... [more]
HSP72_DROSI1.914e-9575.32Major heat shock 70 kDa protein Ba OS=Drosophila s... [more]
HSP72_DROME1.914e-9575.32Major heat shock 70 kDa protein Ba OS=Drosophila m... [more]
HSP71_DROSI1.914e-9574.89Major heat shock 70 kDa protein Ab OS=Drosophila s... [more]
HSP70_THEPA1.914e-9576.92Heat shock 70 kDa protein OS=Theileria parva GN=TP... [more]
HSP71_DROME3.265e-9575.32Major heat shock 70 kDa protein Ab OS=Drosophila m... [more]
HSP70_DROME3.265e-9575.32Major heat shock 70 kDa protein Aa OS=Drosophila m... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404D09EF CTVClemen1 Citrus clementina cDNA clone C31404D09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875481 ID=FC875481|Name=FC875481|organism=Citrus clementina|type=EST|length=703bp
AGGACGACGCCGTCTTATGTGGGGTTCACCGACACGGAGCGTTTGATCGG
GGACGCTGCTAAGAACCAGGTCGCCATGAACCCCACGAACACCGTCTTTG
ATGCAAAGAGGTTGATTGGTAGGAGATTCAGCGATGCATCAGTCCAAGGA
GATATGAAGCTATGGCCATTTAAGGTGATTGCTGGACCAGCTGACAAGCC
CATGATTGGTGTTAACTACAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGG
AAATCTCGTCTATGGTGCTCATCAAGATGCGTGAGATTGCCGAGGCTTAC
CTTGGCTCAACTATTAAGAATGCAGTCGTTACTGTCCCTGCTTACTTCAA
TGACTCACAGAGGCAGGCCACCAAGGATGCTGGTGTCATTGCTGGGCTTA
ATGTGATGCGTATCATCAATGAGCCCACTGCTGCTGCCATTGCTTATGGC
CTTGACAAGAAGGCTACTAGTGTGGGTGAGAAGAATGTGTTGATCTTTGA
TTTGGGTGGTGGTACTTTTGATGTGTCGTTGCTCACTATTGAGGAGGGAA
TCTTTGAAGTGAAGGCTACTGCTGGAGACACTCATCTTGGTGGTGAGGAT
TTTGATAACAGAATGGTGAATCATTTTGTTCAGGAGTTTAAGAGGAAGAA
ACAGAANGATATTAGTGGCAACCCTAGAGCTCTTAGGAGATTGAGGACTG
CTT
back to top