FC875481

Overview
NameFC875481
Unique NameFC875481
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length703
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:223..925. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP74_PARLI (Heat shock 70 kDa protein IV OS=Paracentrotus lividus GN=HSP70IV PE=3 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 4.264e-95
Identity = 174/234 (74.36%), Postives = 199/234 (85.04%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGDAAKNQVAMNPTNT+FDAKRLIGRRF+D+S+Q DMK WPF+VI     KPM+   Y GE K  + EE+SSMVL KM+E AEAYLG  + +AV+TVPAYFND+QRQATKDAGVIAG+NV+RIINEPT AA+AYGLDKK T  GEK+VLIFDLGGGTFDVSLL I++G+FEV  TAGDTHLGGEDFDNR+VNH   EFKRK + D+  NPRA+RRLRTA
Sbjct:   36 RTTPSYVAFTDSERLIGDAAKNQVAMNPTNTIFDAKRLIGRRFNDSSIQADMKHWPFRVI-NKDGKPMLQAEYMGETKTLSPEEVSSMVLTKMKETAEAYLGKKVTSAVITVPAYFNDAQRQATKDAGVIAGINVLRIINEPTRAALAYGLDKKLT--GEKHVLIFDLGGGTFDVSLLAIDDGVFEVLTTAGDTHLGGEDFDNRLVNHTSLEFKRKYKKDMRTNPRAIRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_TRYCR (Heat shock 70 kDa protein OS=Trypanosoma cruzi GN=HSP70 PE=3 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 4.264e-95
Identity = 182/235 (77.45%), Postives = 197/235 (83.83%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRK-KQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGR+FSD  VQ DMK WPFKVI    DKP+I V ++GE K F  EE+SSMVL KM+EIAE+YLG  +K AVVTVPAYFNDSQRQATKDAG IAGL V+RIINEPTAAAIAYGLD K     E+NVLIFDLGGGTFDV+LLTI+ GIFEVKAT GDTHLGGEDFDNR+V HF  EFKRK K  D+S N RALRRLRTA
Sbjct:   36 RTTPSYVAFTDSERLIGDAAKNQVAMNPRNTVFDAKRLIGRKFSDPVVQSDMKHWPFKVITKGDDKPVIQVQFRGETKTFNPEEVSSMVLSKMKEIAESYLGKQVKKAVVTVPAYFNDSQRQATKDAGTIAGLEVLRIINEPTAAAIAYGLD-KVEDGKERNVLIFDLGGGTFDVTLLTIDGGIFEVKATNGDTHLGGEDFDNRLVAHFTDEFKRKNKGKDLSTNLRALRRLRTA 269          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_THEAN (Heat shock 70 kDa protein OS=Theileria annulata GN=TA11610 PE=3 SV=2)

HSP 1 Score: 347.436 bits (890), Expect = 4.264e-95
Identity = 179/234 (76.50%), Postives = 198/234 (84.62%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKR-KKQXDISGNPRALRRLRT 699
            RTTPSYV FTDTERLIGDAAKNQ A NP NT+FDAKRLIGR+F D +VQ DMK WPFKV  GP  KP I V ++GE+K F AEEISSMVL KM+EIAE++LG ++K+ V+TVPAYFNDSQRQATKDAG IAGLNVMRIINEPTAAAIAYGLDKK    GEKNVLIFDLGGGTFDVS+LTIE+GIFEVKATAGDTHLGGEDFDN +V H V++F R     +IS N RALRRLRT
Sbjct:   35 RTTPSYVAFTDTERLIGDAAKNQEARNPENTIFDAKRLIGRKFDDRTVQEDMKHWPFKVTNGPNGKPNIEVTFQGEKKTFHAEEISSMVLTKMKEIAESFLGKSVKDVVITVPAYFNDSQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKGG--GEKNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNLLVEHCVRDFMRLNNGKNISSNKRALRRLRT 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP74_DROME (Major heat shock 70 kDa protein Bbb OS=Drosophila melanogaster GN=Hsp70Bbb PE=2 SV=2)

HSP 1 Score: 346.28 bits (887), Expect = 9.499e-95
Identity = 176/235 (74.89%), Postives = 199/235 (84.68%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEG-IFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGD AKNQVAMNP NTVFDAKRLIGR++ D  +  DMK WPFKV++    KP IGV YKGE K+FA EEISSMVL KM+E AEAYLG +I +AV+TVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAA+AYGLDK      E+NVLIFDLGGGTFDVS+LTI+EG +FEV++TAGDTHLGGEDFDNR+V H  +EFKRK + D+  NPRALRRLRTA
Sbjct:   33 RTTPSYVAFTDSERLIGDPAKNQVAMNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSD-GGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKD--ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVTHLAEEFKRKYKKDLRSNPRALRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_LEIMA (Heat shock 70 kDa protein (Fragment) OS=Leishmania major GN=HSP70 PE=3 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.241e-94
Identity = 179/235 (76.17%), Postives = 198/235 (84.26%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRK-KQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+D+ VQ DMK WPFKV     DKP+I V Y+GEEK F  EEISSMVL+KM+E AEAYLG  +K AVVTVPAYFNDSQRQATKDAG IAGL V+RIINEPTAAAIAYGLD K     E+NVLIFDLGGGTFDV+LLTI+ GIFEVKAT GDTHLGGEDFDNR+V  F +EFKRK K  +++ + RALRRLRTA
Sbjct:   36 RTTPSYVAFTDSERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFNDSVVQSDMKHWPFKVTTKGDDKPVISVQYRGEEKTFTPEEISSMVLLKMKETAEAYLGKQVKKAVVTVPAYFNDSQRQATKDAGTIAGLEVVRIINEPTAAAIAYGLD-KGDDGKERNVLIFDLGGGTFDVTLLTIDRGIFEVKATNGDTHLGGEDFDNRLVTFFTEEFKRKNKGKNLASSHRALRRLRTA 269          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP73_YEAST (Heat shock protein SSA3 OS=Saccharomyces cerevisiae GN=SSA3 PE=1 SV=3)

HSP 1 Score: 345.125 bits (884), Expect = 2.116e-94
Identity = 178/234 (76.07%), Postives = 197/234 (84.19%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQ A+NP NTVFDAKRLIGR+F D  V  D K +PFKVI+    KP++ V YKGE K F  EEISSMVL KM+E AE YLG+T+ +AVVTVPAYFNDSQRQATKDAG IAG+NV+RIINEPTAAAIAYGLDKK  +  E NVLIFDLGGGTFDVSLL+I+EG+FEVKATAGDTHLGGEDFDNR+VNH   EFKRK + DIS N R+LRRLRTA
Sbjct:   34 RTTPSYVAFTDTERLIGDAAKNQAAINPHNTVFDAKRLIGRKFDDPEVTTDAKHFPFKVISRDG-KPVVQVEYKGETKTFTPEEISSMVLSKMKETAENYLGTTVNDAVVTVPAYFNDSQRQATKDAGTIAGMNVLRIINEPTAAAIAYGLDKKGRA--EHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDNRLVNHLATEFKRKTKKDISNNQRSLRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_LEIAM (Heat shock 70 kDa protein OS=Leishmania amazonensis GN=HSP70 PE=2 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 3.991e-93
Identity = 176/235 (74.89%), Postives = 197/235 (83.83%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRK-KQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+D  VQ DMK WPFKV     DKP+I V Y+GEEK F  E+ISSMVL+KM+E AEAYLG  +K AVVTVPAYFNDSQRQATKDAG I+GL V+RIINEPTAAAIAYGLD K     E+NVLIFDLGGGTFDV+LLTI+ GIFEVKAT GDTHLGGEDFDNR+V  F +EFKRK K  +++ + R+LRRLRTA
Sbjct:   36 RTTPSYVAFTDSERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFNDLVVQSDMKHWPFKVTTKGDDKPVISVQYRGEEKTFTPEKISSMVLLKMKETAEAYLGKQVKKAVVTVPAYFNDSQRQATKDAGTISGLEVLRIINEPTAAAIAYGLD-KGDDGKERNVLIFDLGGGTFDVTLLTIDGGIFEVKATNGDTHLGGEDFDNRLVTFFTEEFKRKNKGKNLASSHRSLRRLRTA 269          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP74_YEAST (Heat shock protein SSA4 OS=Saccharomyces cerevisiae GN=SSA4 PE=1 SV=3)

HSP 1 Score: 339.732 bits (870), Expect = 8.891e-93
Identity = 175/234 (74.79%), Postives = 196/234 (83.76%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQ AMNP NTVFDAKRLIGR+F D  V  D K +PFKVI     KP++ V YKGE K F  EEISSM+L KM+E AE +LG+ +K+AVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKK  S  E NVLIFDLGGGTFDVSLL+I+EG+FEVKATAGDTHLGGEDFD+R+VN   +EFKRK + D++ N R+LRRLRTA
Sbjct:   34 RTTPSYVAFTDTERLIGDAAKNQAAMNPHNTVFDAKRLIGRKFDDPEVTNDAKHYPFKVI-DKGGKPVVQVEYKGETKTFTPEEISSMILTKMKETAENFLGTEVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKK--SQKEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDSRLVNFLAEEFKRKNKKDLTTNQRSLRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP71_PARBA (Heat shock 70 kDa protein 1 OS=Paracoccidioides brasiliensis (strain ATCC MYA-826 / Pb01) GN=HSP70-1 PE=1 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 1.517e-92
Identity = 178/234 (76.07%), Postives = 194/234 (82.91%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            R TPS+V FTDTERLIGDAAKNQVAMNP  TVF+AKRLIGR+F+D  VQ DMK +PFK I      P I V ++GE K F  E ISSM   K REIAE+YLG T+ NAVVTVPAYFNDSQRQ TKDAG+IAGLNV+RIINEPTAAAIAYGLDKKA   GE+NVLI DLGGGTFDVSLLTIEEGIFEVK+TAGDTH GGEDFDNR+VNHFV EFKRK + D+S N RALRRLRTA
Sbjct:   34 RNTPSFVAFTDTERLIGDAAKNQVAMNP-QTVFEAKRLIGRKFADPEVQADMKHFPFK-ITDKGGNPKIQVEFRGEGKHFTPEGISSMFRRKKREIAESYLGGTVNNAVVTVPAYFNDSQRQVTKDAGLIAGLNVLRIINEPTAAAIAYGLDKKAE--GERNVLILDLGGGTFDVSLLTIEEGIFEVKSTAGDTHFGGEDFDNRLVNHFVNEFKRKHKKDLSSNARALRRLRTA 263          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP77_HUMAN (Putative heat shock 70 kDa protein 7 OS=Homo sapiens GN=HSPA7 PE=5 SV=2)

HSP 1 Score: 338.191 bits (866), Expect = 2.587e-92
Identity = 168/234 (71.79%), Postives = 200/234 (85.47%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERL+GDAAK+Q A+NP NTVFDAKRLIGR+F+D +VQ DMK WPF+V++    KP + V Y+GE+K F  EEISSMVL KM+E AEAYLG  +K+AV+TVP YF++SQRQATKDAG IAGL V+ IINE TAAAIAYGLD++    G++NVLIFDLGGGTFDVS+L+I+ G+FEVKATAGDTHLGGEDFDNR+VNHF++EF+RK   D+SGN RALRRLRTA
Sbjct:   38 RTTPSYVAFTDTERLVGDAAKSQAALNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFQVVS-EGGKPKVRVCYRGEDKTFYPEEISSMVLSKMKETAEAYLGQPVKHAVITVPTYFSNSQRQATKDAGAIAGLKVLPIINEATAAAIAYGLDRRGA--GKRNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRKHGKDLSGNKRALRRLRTA 268          
The following BLAST results are available for this feature:
BLAST of FC875481 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP74_PARLI4.264e-9574.36Heat shock 70 kDa protein IV OS=Paracentrotus livi... [more]
HSP70_TRYCR4.264e-9577.45Heat shock 70 kDa protein OS=Trypanosoma cruzi GN=... [more]
HSP70_THEAN4.264e-9576.50Heat shock 70 kDa protein OS=Theileria annulata GN... [more]
HSP74_DROME9.499e-9574.89Major heat shock 70 kDa protein Bbb OS=Drosophila ... [more]
HSP70_LEIMA1.241e-9476.17Heat shock 70 kDa protein (Fragment) OS=Leishmania... [more]
HSP73_YEAST2.116e-9476.07Heat shock protein SSA3 OS=Saccharomyces cerevisia... [more]
HSP70_LEIAM3.991e-9374.89Heat shock 70 kDa protein OS=Leishmania amazonensi... [more]
HSP74_YEAST8.891e-9374.79Heat shock protein SSA4 OS=Saccharomyces cerevisia... [more]
HSP71_PARBA1.517e-9276.07Heat shock 70 kDa protein 1 OS=Paracoccidioides br... [more]
HSP77_HUMAN2.587e-9271.79Putative heat shock 70 kDa protein 7 OS=Homo sapie... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404D09EF CTVClemen1 Citrus clementina cDNA clone C31404D09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875481 ID=FC875481|Name=FC875481|organism=Citrus clementina|type=EST|length=703bp
AGGACGACGCCGTCTTATGTGGGGTTCACCGACACGGAGCGTTTGATCGG
GGACGCTGCTAAGAACCAGGTCGCCATGAACCCCACGAACACCGTCTTTG
ATGCAAAGAGGTTGATTGGTAGGAGATTCAGCGATGCATCAGTCCAAGGA
GATATGAAGCTATGGCCATTTAAGGTGATTGCTGGACCAGCTGACAAGCC
CATGATTGGTGTTAACTACAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGG
AAATCTCGTCTATGGTGCTCATCAAGATGCGTGAGATTGCCGAGGCTTAC
CTTGGCTCAACTATTAAGAATGCAGTCGTTACTGTCCCTGCTTACTTCAA
TGACTCACAGAGGCAGGCCACCAAGGATGCTGGTGTCATTGCTGGGCTTA
ATGTGATGCGTATCATCAATGAGCCCACTGCTGCTGCCATTGCTTATGGC
CTTGACAAGAAGGCTACTAGTGTGGGTGAGAAGAATGTGTTGATCTTTGA
TTTGGGTGGTGGTACTTTTGATGTGTCGTTGCTCACTATTGAGGAGGGAA
TCTTTGAAGTGAAGGCTACTGCTGGAGACACTCATCTTGGTGGTGAGGAT
TTTGATAACAGAATGGTGAATCATTTTGTTCAGGAGTTTAAGAGGAAGAA
ACAGAANGATATTAGTGGCAACCCTAGAGCTCTTAGGAGATTGAGGACTG
CTT
back to top